KEGG   Glaciecola nitratireducens: GNIT_2754
Entry
GNIT_2754         CDS       T01632                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
gni  Glaciecola nitratireducens
Pathway
gni03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:gni00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    GNIT_2754
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gni03400]
    GNIT_2754
Enzymes [BR:gni01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     GNIT_2754
DNA repair and recombination proteins [BR:gni03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     GNIT_2754
 Prokaryotic type
     GNIT_2754
SSDB
Motif
Pfam: UDG
Other DBs
NCBI-ProteinID: AEP30851
UniProt: G4QID7
LinkDB
Position
complement(3049399..3050106)
AA seq 235 aa
MQSWDPLLDLKGVSVDESAKLNNISDTFTAGLRSALAHVAIERAAGKVVYPADAEVFNAF
KLTQADALKVVILGQDPYHGPNQSHGLCFSVRKGNKIPPSLRNIYKELAADIPNFVIPSH
GDLSHWAEQGVLLLNTVLTVEQGQAHSHKKIGWEEFTDGVISTINRECENLIFLLWGAPA
QKKAALINEKRHTILTAVHPSPLSAHRGFFGCQHFSKTNQILSSQGKKPIDWQPK
NT seq 708 nt   +upstreamnt  +downstreamnt
atgcaatcttgggatccgctcctcgaccttaaaggggtcagcgttgatgaaagtgctaag
ctaaacaacattagcgatacatttaccgcaggcttacgaagcgcccttgctcatgtagcg
atagaacgagctgcgggcaaggttgtctatccggctgacgcagaggtgtttaacgctttc
aaactaactcaagctgacgccttgaaagtggtgattttaggacaggacccataccacggc
ccaaaccagtcccatggtttatgcttctcggttcgcaaagggaataaaatcccaccctcg
ttgcgcaatatctacaaagaactcgcagcagacattcctaatttcgtgatacctagtcat
ggtgatttaagtcactgggcagagcagggcgttttattgttgaataccgtgttgacggtc
gagcagggtcaggctcattctcataaaaaaataggttgggaggaatttactgacggcgta
atttcaacaattaaccgtgagtgcgagaatctgatatttttgttatggggtgcgccagca
cagaagaaagcagcactcattaatgaaaaacggcacactattttgaccgcggttcaccca
tctccgttatctgcacatcgtggtttttttggctgtcagcattttagcaaaacgaatcag
atactcagctcacagggtaagaagccaattgattggcagcctaaatag

DBGET integrated database retrieval system