KEGG   Glaciecola nitratireducens: GNIT_2907Help
Entry
GNIT_2907         CDS       T01632                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gni  Glaciecola nitratireducens
Brite
KEGG Orthology (KO) [BR:gni00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GNIT_2907 (ahpF)
Enzymes [BR:gni01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GNIT_2907 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 DAO HI0933_like GIDA FAD_binding_2 FAD_oxidored NAD_binding_8 AlaDh_PNT_C Thi4 NAD_binding_7 Thioredoxin_4 Lycopene_cycl Glutaredoxin Thioredoxin_9 FAD_binding_3 DSBA PALP ABC_transp_aux K_oxygenase RgpF 3HCDH_N Amino_oxidase Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: AEP31004
UniProt: G4QMS1
LinkDB All DBs
Position
complement(3223557..3225146)
Genome map
AA seq 529 aa AA seqDB search
MLTTDILKALAQYTADMKHAVTLVLQTGEHEKRAELKEMLTQFSSISDKITLEERDDSAR
LRSPVSFGLEVNGKPSGITFSGVPGGHEFNSFVLAVLQAGGVKLKLNESIQNMIKKVTKP
LKFQVYVSLSCHACPDVVQAMNQFALLNDNIEAEMIDGSVYPDLVEENGIQGVPTVFMNG
KVFATGQIDTAKLIDKLTEAQPEMLEANDAAEQLPMQDVTIIGGGPAGVAAAIYSARKGL
KVTIVADRFGGQVKDTMGIENLISVTKTTGPQLTTSLVEHLKAHEVTVREHLRVDKIEKG
DIKTLTLTSGEVIETKTIIIATGANWRELGVPGEKENIGNGVAYCPHCDGPFYKGKDVAV
IGGGNSGVEAALDLAGIVKSVTVFEFLPELKADQVLIDQINARDNIKVIKNAATKEIHAQ
DGKVNAIEYTDRATNEAHKLTLQGVFVQIGLVPNSTVLKGVVDLTKHGEVIINEKGQTSE
AGIYACGDVTTVPYKQIVIAMGEGAKASLAAYDYILMSKPVKKEESVAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttaacaacagatattttaaaagctttagcgcaatatacagcagacatgaaacatgca
gttaccctggtattacaaaccggagagcatgaaaagcgtgctgaactgaaagaaatgctg
actcagttttcttcaatttcagacaaaattacgcttgaagagcgtgacgactctgctcgt
ctgcgtagcccagttagcttcggtttagaagtgaacggaaagccaagcggtattacattt
tctggcgtaccaggcggacatgagttcaactcatttgtgttagcggtacttcaagccggt
ggcgtgaagctcaagttgaatgaaagcattcagaatatgatcaagaaggtaacgaaacca
cttaaatttcaggtatacgttagcttaagctgtcacgcatgtcctgacgtcgtccaagca
atgaatcagtttgctttattgaacgataatattgaagctgaaatgatcgatggaagcgtt
tacccagatctagttgaagaaaatggtattcaaggcgtgccgacggtatttatgaacggc
aaagtatttgcgacgggtcaaatagatacagcaaaattaattgataagttgacagaagca
caacccgaaatgttggaggctaacgacgctgctgagcaacttccgatgcaagacgttacg
attattggcggtggtcctgctggcgttgcagctgcaatatattcggcgcgaaaaggttta
aaagtgacaatcgttgcagatcgttttggtggacaggttaaagatactatgggtattgaa
aacttaatttcagtcacaaaaacaacgggtccacagttaaccacttcattagtggagcat
ttgaaagctcatgaagtcaccgtccgtgagcatttacgtgtggacaaaattgagaaaggt
gacatcaaaaccttgaccctgacgtcaggtgaagtgattgaaactaaaacgattatcatc
gcgactggtgcgaattggagagagctaggcgttccgggtgagaaagaaaatatcggtaac
ggtgtggcatactgcccgcactgcgatgggcctttttacaagggtaaggacgttgctgtg
ataggcggtgggaactcgggcgttgaagctgcgctagatttggctggcatcgttaagtct
gtcactgtatttgagtttttacctgaactgaaagcagaccaagtgctaattgaccaaatc
aacgcgcgagataatatcaaagttatcaaaaacgcggcgaccaaagaaattcatgctcaa
gatggtaaagttaatgccattgaatatacagaccgagccactaatgaagctcataaatta
acgcttcaaggtgtattcgtgcaaattggtctagtgccaaacagcacggtgttgaagggc
gtggtcgacctcactaaacatggtgaagttattattaatgagaaaggtcaaacaagcgaa
gcaggtatatacgcttgcggtgacgtaacaaccgttccttataagcaaatcgtaattgcg
atgggcgaaggcgcaaaagcgtcactggctgcttatgattatatcttaatgagtaaacca
gttaagaaagaagaatctgtagctgcataa

DBGET integrated database retrieval system