KEGG   Glaciecola nitratireducens: GNIT_3081Help
Entry
GNIT_3081         CDS       T01632                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
gni  Glaciecola nitratireducens
Pathway
gni03030  DNA replication
gni03410  Base excision repair
gni03420  Nucleotide excision repair
gni03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:gni00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    GNIT_3081
   03410 Base excision repair
    GNIT_3081
   03420 Nucleotide excision repair
    GNIT_3081
   03430 Mismatch repair
    GNIT_3081
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gni03032]
    GNIT_3081
   03400 DNA repair and recombination proteins [BR:gni03400]
    GNIT_3081
Enzymes [BR:gni01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     GNIT_3081
    6.5.1.6  DNA ligase (ATP or NAD+)
     GNIT_3081
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     GNIT_3081
DNA replication proteins [BR:gni03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    GNIT_3081
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     GNIT_3081
DNA repair and recombination proteins [BR:gni03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     GNIT_3081
   NER (nucleotide excision repair)
    Other NER factors
     GNIT_3081
   MMR (mismatch exicision repair)
    Other MMR factors
     GNIT_3081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N RNA_ligase CobD_Cbib
Motif
Other DBs
NCBI-ProteinID: AEP31176
UniProt: G4QIM1
LinkDB All DBs
Position
3424998..3426623
Genome map
AA seq 541 aa AA seqDB search
MDAFSRLVDQLYFTSSNLAKSAILRDYLRTTPNPDRGWAIAAIAGTLNFDLFKRKLIKDL
ITARVDPVLFDLSYDYVGEMSETVAHLWPSTGEATKELSKNVSLPSLHELVVLFKQSNKQ
QVEEILVSLLDRMTAPQRWALIKLGTRGLRIGLSARFLKKVLAEYANELPQNNISTEDIE
RVWHGVEPPYLDLFDWLEGKADKPDVSKKITFQPVMLSHPLSDNELTIISSEHWQAEWKY
DGIRVQLVCNENGKALFSRTGDDISGSFPDLLDSIDETRVSGVFDGELLAMQDEQINSFN
QLQQRLNKKKPSKKLMQEIPVGMMLYDALVINGSDLREKALRIRSSQLTAWYELQSNRLL
KLSVPLVFNNIEELRALREKANISDNGYIEGLMLKNKDSIYVAGRPKGQWYKWKRDAKLV
DAVIMYAQRGHGKRSSFYSDYTFGCWQDDKLFPIGKAYSGFTDDELKQLDKWIRNNTIGR
FGPVKEVKKELVFEVAFDSVHHSKSHKSGVALRFPRIHRIRWDKPASEADQLTTLVSLIE
K
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgttttcgaggcttgttgatcaactctactttacctctagcaacttagctaaa
tcagctattttgcgcgactacttgcgcacaacgccaaatccagatagaggttgggcgata
gccgctattgccggcactctcaattttgatttattcaagcgaaaactcataaaggatttg
ataaccgctcgcgttgatcccgtattgttcgatttatcatatgattatgtgggtgaaatg
agtgaaaccgttgcccacttgtggccaagcactggcgaagcaacgaaagagctttcaaaa
aatgtatcattacccagtttgcatgagctcgtcgtgctttttaaacaaagcaacaagcag
caagtagaagagatcttggtaagcctactagaccgaatgaccgccccgcagcgctgggcc
ttaattaagttaggcacacgcggtttacgtatcggtttatcagcccgattcctaaagaaa
gtattggcggaatacgccaacgaattaccgcaaaataatataagcaccgaagatattgaa
cgagtatggcatggcgtggaaccaccctatctcgacttgtttgactggttggagggtaaa
gcggataaacccgatgtatcaaaaaagattacgtttcagccggtcatgctctcccacccg
ctaagtgacaacgaactcacaattatttcatcagagcattggcaagccgagtggaaatat
gacggaatacgtgtgcagttagtctgcaatgaaaacggtaaagccttgtttagccgcaca
ggcgacgatattagcggcagttttcctgaccttctcgatagtattgatgagacgcgtgta
tctggcgtatttgatggcgagctactagcgatgcaagacgagcagattaatagcttcaac
caacttcagcagcgtttgaataaaaagaagcctagcaaaaaattgatgcaagaaattccc
gttggaatgatgctttatgatgccttagtcattaacggtagcgacctaagagaaaaagca
ttgcgaatacgcagctcgcaattaacagcttggtatgaactacaatcaaatagactcttg
aagctttccgtccctctagtttttaacaatattgaagaacttcgagcccttcgtgaaaaa
gctaatatctctgacaacggctacattgaggggctcatgctaaagaataaagacagtatt
tatgtcgcaggcagacccaaaggtcaatggtacaaatggaagcgagatgcgaagctagtg
gacgccgttatcatgtatgcacagagaggacacggcaaacgatcttctttctattctgac
tacacctttggttgctggcaggatgataagttattccccataggaaaggcctatagtggt
tttactgatgatgagttgaagcaactcgataaatggataaggaacaataccattggacgt
tttgggccggtgaaagaggtaaaaaaggaattggtttttgaagtcgcgttcgactctgtt
caccattctaaaagtcataagtcgggcgttgcacttcgctttcctagaattcatcgaata
aggtgggacaaaccagcaagtgaggctgaccaactaaccactctagtatcgctgattgag
aagtag

DBGET integrated database retrieval system