KEGG   Glaciecola nitratireducens: GNIT_3194
Entry
GNIT_3194         CDS       T01632                                 

Gene name
mutY
Definition
(GenBank) A/G-specific adenine glycosylase
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
gni  Glaciecola nitratireducens
Pathway
gni03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:gni00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    GNIT_3194 (mutY)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gni03400]
    GNIT_3194 (mutY)
Enzymes [BR:gni01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     GNIT_3194 (mutY)
DNA repair and recombination proteins [BR:gni03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     GNIT_3194 (mutY)
 Prokaryotic type
     GNIT_3194 (mutY)
SSDB
Motif
Pfam: HhH-GPD NUDIX_4 HHH EndIII_4Fe-2S HHH_5 HHH_8 Whib
Other DBs
NCBI-ProteinID: AEP31288
UniProt: G4QE14
LinkDB
Position
complement(3556286..3557377)
AA seq 363 aa
MLQQTQVATVIPYYNTFMQRFPTVTDLANAPVDEVLHLWTGLGYYARARNLHKAAQQVRD
LHSGEFPTAFDEVIALPGIGRSTAAAVLSLALNQAYAIMDGNVKRVLTRYMAIEGWPGVK
KIEDRLWIEAEALKPGSADEKLGLQASGETSKTNSAAPRYGDYTQAIMDLGATVCTRSKP
KCDDCPMQSNCLAFAQGKQTEFPFKKPKKIIPTKYTTMLIPSFNGQVLMQQRPSSGIWGG
LWGFLETGFDKELEKTTDEALLLLESSLLQVNLKDAKIQELRTFKHTFSHFHLMILPVLI
ELKEPPLQTVCESLTAPKNTDFDNDAYEDEHIRRQIWFDSHNPSKIGLSAPTMKILEMLK
RDY
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgctgcaacagacccaagtggcaaccgttattccttattacaatacattcatgcagcgc
tttcctacggttactgatttagccaatgcgcctgtagatgaagtactgcatttgtggact
ggcttaggttactacgctagggcgaggaacttacacaaagctgcccagcaggtgcgagat
ttgcactctggtgaatttccaacagcctttgacgaggttattgcgctaccgggaattgga
cgctctaccgctgctgctgttttgtcattagcgctaaatcaagcgtacgcaatcatggat
ggtaatgtaaagcgagtacttactcgctatatggctattgaaggttggccaggtgtcaaa
aaaatagaagacaggctatggattgaagctgaggccttgaagccaggctctgccgatgaa
aaactgggattacaagctagcggcgaaacatctaaaacgaacagtgcggcgccaaggtac
ggtgattacactcaagcaataatggatttgggggcgaccgtatgcacgcgttcaaaacct
aagtgcgatgattgccctatgcagtcgaactgccttgcttttgctcaaggaaagcaaact
gagtttccatttaagaagccgaagaaaataattcccacaaaatatacgacaatgttaatt
ccttcgtttaacggtcaagtgttgatgcaacaaagaccttcgtcaggtatttggggaggg
ctatggggcttcttagaaacaggttttgataaagagctagaaaaaaccaccgatgaagcg
ctgttactactggaaagtagtttgctacaggtaaatttgaaagatgcaaaaatacaagag
cttaggacttttaagcatacctttagtcattttcatctgatgattttgcctgtgcttatt
gagttaaaagagcctcctttgcaaacggtatgtgagagccttactgcaccaaaaaatacc
gattttgataatgatgcctacgaggatgagcacattagaaggcaaatttggtttgattcg
cacaacccaagtaaaattggtctgtcggcaccgacaatgaaaatattagagatgttgaaa
agagactactag

DBGET integrated database retrieval system