KEGG   Glaciecola nitratireducens: GNIT_3341
Entry
GNIT_3341         CDS       T01632                                 

Definition
(GenBank) AraC family transcriptional regulator
  KO
K13529  AraC family transcriptional regulator, regulatory protein of adaptative response / DNA-3-methyladenine glycosylase II [EC:3.2.2.21]
Organism
gni  Glaciecola nitratireducens
Pathway
gni03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:gni00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    GNIT_3341
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gni03000]
    GNIT_3341
   03400 DNA repair and recombination proteins [BR:gni03400]
    GNIT_3341
Enzymes [BR:gni01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     GNIT_3341
Transcription factors [BR:gni03000]
 Prokaryotic type
  Helix-turn-helix
   AraC family
    GNIT_3341
DNA repair and recombination proteins [BR:gni03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     GNIT_3341
SSDB
Motif
Pfam: AlkA_N Ada_Zn_binding HTH_18 HTH_AraC HTH_23 HTH_11
Other DBs
NCBI-ProteinID: AEP31435
UniProt: G4QN16
LinkDB
Position
complement(3727525..3729027)
AA seq 500 aa
MLNLPIPIIQKARIARDPRFDGLFFIGVKTTGIFCRPICKARMPLEKNVAYYNNAITAMN
AGFRPCLMCRPDSAPGSYAWKGVETTVERGVKLLSAHLSLSIAEIADKLGISTRYFTKLF
EQHLQISPKRYQLLTRLLFAKQLLHESSLPIEQVAQACGFNAAKPLQHHMKLNTGLTPSQ
IRRSNRAKAETEASKVTIHLSYRPPYQWQHIRDFFKLRQIESNEKVENDSICKVLRFGES
RVLFHAVHQPEKNRFEVTFSLTDLRLLKTGIASLKKMLDLNCEPNAIHDALIQAGMPPQN
VLNGLRLPGIIDKFEAGCRAIVGQQVSVKAAIGQLNLLQNTLNKNQKNKGPGSLKNAPHP
DSNQVAFESLGLIGFVTAKQVAEADLSFLKMPNARKETLKAFAQFMLEQPEASIDEWLHI
KGIGAWTVNYVTMRTSDSPDTFLATDLVVKNQIKQLADRQVGVKQELAAPWRSYLTLSLW
NLSNGAPTPSENVKKEALYE
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgttgaacctacctattcctattattcaaaaagcgcgtatcgcgagagatccgcgtttt
gatggattattttttatcggagtaaagacaacaggtattttctgccgtccaatttgcaaa
gcgcgtatgcctttagagaaaaacgtcgcgtattataataatgcgatcactgctatgaat
gctgggtttcgaccttgtttaatgtgtcgtcccgacagtgccccaggttcttatgcttgg
aagggcgttgaaactacggttgaacgcggtgtgaaattgctcagcgcacacctttcacta
agtattgctgaaattgctgataagcttggtattagcacccgctattttaccaagttgttc
gaacagcatttacagatttcgcccaagcgctatcagttacttactcgcttactttttgcc
aagcagttgctgcacgagtcaagtttaccgatagagcaggttgcgcaggcctgtggattc
aatgcagctaagcccttgcagcatcacatgaagctaaatacaggccttacgccaagtcaa
attaggcgctccaacagggcaaaagcagagacagaagcaagtaaggtaacgattcaccta
tcttacaggccgccctatcaatggcagcatattcgagatttttttaaactgagacaaatt
gaatcgaatgaaaaagtagaaaacgatagtatttgcaaagtgcttcgctttggagaaagt
cgcgttttgtttcacgctgtccatcagcctgagaaaaaccgctttgaagttactttctca
ctaacagatttacgtttactcaagaccggcattgcgtccttgaaaaaaatgctagatttg
aactgcgaaccaaacgcaattcatgacgcattaatacaagcaggaatgccaccgcagaat
gttttaaatggccttcgattaccaggcatcatcgataagttcgaggcaggatgtcgagcg
attgtcggacaacaagtcagtgtaaaagccgccatcggacaattaaacctactacaaaac
accctcaacaaaaaccaaaaaaacaaggggccaggttccttgaaaaatgctccgcacccg
gatagcaatcaagtagccttcgaatcgctgggactcattggttttgtcacggcaaaacaa
gttgctgaggcagatttgtcttttttgaaaatgcccaatgctcgcaaggagaccctcaag
gcctttgcgcagtttatgttagaacaacctgaagcaagcatagatgagtggctgcatatt
aaaggcatcggcgcatggaccgttaattacgttacgatgcgcactagcgacagtccagac
acctttttagcaacggacttagtggttaaaaaccaaattaaacaattagccgataggcag
gttggcgtgaaacaggaattggctgccccatggcgaagctaccttactttgagcctttgg
aatttatctaatggtgcgccaactccttcagaaaacgtaaaaaaggaagcgctatatgaa
taa

DBGET integrated database retrieval system