KEGG   Geodermatophilus obscurus: Gobs_0119Help
Entry
Gobs_0119         CDS       T01163                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
gob  Geodermatophilus obscurus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DUF3220
Motif
Other DBs
NCBI-ProteinID: ADB72925
UniProt: D2SGP3
LinkDB All DBs
Position
complement(127740..128753)
Genome map
AA seq 337 aa AA seqDB search
MPLSVPGLPDVPTELAGPVAVELAKPVRDLPRADALPGGVLYEPKWDGYRLVVVRTGGTT
RVWSRQGRDLSSRFPDVVAAAVAQVPAGTVLDGEVVVWNGSRLDFGLLQQRMVATAGRIG
ALVAAAPASYVAFDLLALGGADLRGRRLRERRAALEDLAARWAPPMQLSPVTADPAEARQ
WSADFRPAGVEGLVAKGAGTRYAPGRREWLKVKSWETTEVLAGGVIGPLERPSQLVAGRY
RDGELVVVGRTSPLSPAQSAELADVLTPAGPDHPWPERIGTGAFGGGRLSVPLTRVRPDV
VVEVSADAALQAGVFRHPLRFVRVRPDLTPEDVPAVP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgccgctgtccgtgcccggcctgcccgacgtgccgaccgagctggccggcccggtcgcg
gtggagctggccaagccggtgcgcgacctgccgcgggccgacgcgctgcccggcggggtg
ctctacgagcccaagtgggacggctaccgcctggtcgtcgtccgcaccggcggcacgacc
cgggtctggtcccggcagggccgcgacctgtcctcccgcttcccggacgtcgtcgccgcg
gccgtggcccaggtgcccgcgggcacggtgctcgacggcgaggtcgtcgtctggaacggc
tcccggctggacttcggcctgctccagcagcggatggtcgccaccgccggccggatcggt
gccctggtcgccgccgcgcccgcctcctacgtcgccttcgacctgctggcgctgggcggc
gcggacctgcgggggcgccggctgcgggagcggcgggccgcgctggaggacctcgccgcc
cgctgggccccgccgatgcagctctcaccggtcaccgccgaccccgccgaggcccggcag
tggtcggccgacttccggcccgccggggtggaggggctggtcgccaagggcgccggcacc
cgctacgcgcccggccggcgggagtggctgaaggtgaagtcgtgggagaccaccgaggtg
ctcgccggcggcgtcatcggaccgctggagcggccgagccagctcgtggccgggcggtac
cgggacggcgagctggtcgtcgtcggccggaccagcccgctgtcgcccgcgcagtccgcc
gagctggccgacgtcctcaccccggccgggccggaccacccgtggccggagcggatcggc
accggcgccttcggcggcggccggctgtcggtgccgctgacccgcgtccgcccggacgtc
gtcgtcgaggtcagcgcggacgccgcgctgcaggccggcgtcttccgccacccgctgcgc
ttcgtgcgggtccgcccggacctcaccccggaggacgtcccggcggtgccctga

DBGET integrated database retrieval system