KEGG   Geodermatophilus obscurus: Gobs_0841Help
Entry
Gobs_0841         CDS       T01163                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00620  Pyruvate metabolism
gob00680  Methane metabolism
gob01100  Metabolic pathways
gob01120  Microbial metabolism in diverse environments
gob01200  Carbon metabolism
Module
gob_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:gob00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Gobs_0841
  09102 Energy metabolism
   00680 Methane metabolism
    Gobs_0841
Enzymes [BR:gob01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Gobs_0841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ADB73605
UniProt: D2S8W2
LinkDB All DBs
Position
892389..895208
Genome map
AA seq 939 aa AA seqDB search
MSEATVDVADLRHHGGAEEDGADAADAPLREDIRLLGRVLGEVIREQSGDDVLALVEATR
VEAFRLRRSEVDRADVAARLDGLDVRSANHVIRAFSHFSLLANLAEDVHHERRRRFHRLE
GSPPQKGSLAATFELLDAAHLDADVVARELAGALVSPVVTAHPTEVRRRTISRVQRQVTE
LIRRRDRSAPGEADDPAWSGELQRAVLTLWQTALLRLSRLRLADEIDEALRYYEMSLFEV
VPAINAELRRALHARWPSAGSDRPVLRPGSWIGGDRDGNPFVTADAVHLASTRQAQTALG
HHLSELLALHDELSMSDRLITPTPELAQLAAASGDDSRFRADEPYRRALYGVHARLAATA
QRVLGSVPGPPPHAVLEPYATPEEVLADLATVDASLRAHGAAALADDRLARLREAVEVFG
FHLAGLDMRQNSAVHAEVLAELFAWAGVCPDYAALDEKQRVELLVGELRMRRPLVRPDAA
LSDLARGELDVLLAAADQVRALGPEAVPNYVISMCESVSDVLEVAVLLKEVGLLDPGGDG
GPTCPVGISPLFETIGDLQHAAETLTAVLGQPLYRALLRNRGDVQEVMLGYSDSNKDGGY
LAANWALYRAELALVEVARREGVRLRLFHGRGGTVGRGGGPSYDAIRAQPPGAVAGALRI
TEQGEVIAAKYAEPDRARRNLEAMVAATLEASLLDTEGLGDDAEPAYALLDDLAARAQQA
YRALVHETPGFVEWFRAATPIGELAELNIGSRPPSRKAGDSIADLRAIPWVFSWSQARIM
LPGWYGTGSALESWVEGDPARLTRLQELHRRWPWFRTMLSNMGMVLAKTDLDLAARYAEL
VPDEQLRHRVFDQLTAEHERSCRMLLAVTGDDRLLADNPALARSIRNRFPYLEPLHHLQV
EMLRRRRGHDGQDGDDDELVRRNIQLTINGIATALRNSG
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaagccaccgtcgacgtcgccgacctgcgccaccacggaggagccgaggaggac
ggagccgacgccgccgacgccccgctgcgcgaggacatccggctgctcggccgggtcctc
ggcgaggtgatccgcgagcagtcgggggacgacgtcctcgcgctcgtcgaggccacccgc
gtggaggccttccggctgcgccgctcggaggtcgaccgcgccgacgtcgccgcccggctg
gacggcctcgacgtccgctcggccaaccacgtcatccgcgcgttcagccacttctcgctg
ctggccaacctcgccgaggacgtgcaccacgagcgccgccgccgcttccaccgcctggag
ggctcgccgccgcagaagggcagcctggcggcgaccttcgagctgctcgacgccgcgcac
ctcgacgccgacgtcgtcgcccgcgagctggccggcgcactggtctccccggtcgtcacc
gcgcacccgaccgaggtccgccgccgcaccatctcccgcgtgcagcggcaggtcaccgag
ctgatccgccggcgggaccgctccgcccccggggaggccgacgacccggcgtggtcgggg
gagctgcagcgcgcggtgctcaccctctggcagacggccctgctgcggctgtcccggctg
cggctggccgacgagatcgacgaggcgctgcgctactacgagatgtcgctgttcgaggtg
gtcccggcgatcaacgccgagctgcgccgcgccctgcacgcgcgctggccgtcggccggg
tcggaccgaccggtgctgcggccgggctcgtggatcggcggcgaccgcgacggcaacccc
ttcgtcaccgccgatgccgtccacctggccagcacccggcaggcccagacggcgctgggc
caccacctgtccgagctgctggcgctgcacgacgagctgtcgatgtccgatcggctgatc
acgccgacgcctgagctggcgcagctggccgcggcctccggcgacgactcgcggttccgc
gccgacgagccctaccgccgtgccctgtacggcgtgcacgcccggctggccgcgacggct
cagcgggtgctcgggtcggtgcccggcccgccgccgcacgccgtcctcgagccctacgcg
acccccgaggaggtgctggccgacctcgccacggtcgacgcctcgctgcgcgcgcacggc
gccgctgcgctggccgacgaccggctggcccggctgcgggaggccgtggaggtcttcggc
ttccacctggcggggctggacatgcggcagaactccgccgtccacgccgaggtgctggcc
gagctgttcgcctgggcgggggtctgccccgactacgcggcgctggacgagaagcagcgg
gtcgagctgctggtcggcgagctgcggatgcgccgcccgctggtccgcccggacgccgcg
ctctccgacctggcccgtggcgagctcgacgtgctgctcgccgcggccgaccaggtccgc
gcgctggggccggaggccgtgccgaactacgtcatcagcatgtgcgagtcggtcagcgac
gtcctcgaggtcgccgtcctgctcaaggaggtgggcctgctcgaccccggcggggacggc
ggtcccacctgcccggtcggcatctccccgctgttcgagaccatcggcgacctgcagcac
gccgcggagacgctgaccgccgtcctgggccagccgctctaccgggcgctgctgcgcaat
cggggtgacgtgcaggaagtcatgctcggctactccgacagcaacaaggacggcggctac
ctcgcggccaactgggcgctctaccgggccgagctggcgctggtcgaggtcgcccggcgc
gagggcgtccggctgcggctgttccacggccgcggcggcaccgtcggccgcggcggcggg
cccagctacgacgcgatccgggcccagccgcccggtgcggtggccggggcgctgcggatc
accgagcagggcgaggtcatcgccgccaagtacgccgagcccgaccgcgcccggcgcaac
ctggaggccatggtcgcggccacgctggaggccagcctgctcgacaccgagggcctgggg
gacgacgccgagccggcctacgccctgctcgacgacctggccgcccgcgcccagcaggcc
taccgggcgctggtgcacgagacgccgggcttcgtcgagtggttccgcgcggccaccccg
atcggcgagctggccgagctgaacatcggcagccggccgccgtcgcgcaaggcgggggac
tcgatcgccgacctgcgcgccatcccctgggtgttcagctggtcgcaggcgcggatcatg
ctgcccggctggtacggcaccgggtcggccctggagagctgggtcgagggcgacccggcc
cggctcacgcggctgcaggagctgcacaggcgctggccgtggttccgcacgatgctgtcc
aacatgggcatggtgctggccaagaccgacctcgacctggccgcccgctacgccgagctg
gtgcccgacgagcagctgcggcaccgggtgttcgaccagctgaccgccgagcacgagcgc
agctgccggatgctgctggcggtcaccggcgacgaccggctgctggccgacaacccggcg
ctggcgcggtcgatccgcaaccgcttcccctacctcgagcccctgcaccacctgcaggtg
gagatgctgcgccggcgccgcgggcacgacgggcaggacggggacgacgacgagctggtc
cgccgcaacatccagctgaccatcaacggcatcgccacggccctgcgcaacagtggctga

DBGET integrated database retrieval system