KEGG   Geodermatophilus obscurus: Gobs_1947Help
Entry
Gobs_1947         CDS       T01163                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
gob  Geodermatophilus obscurus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ADB74643
UniProt: D2SEV3
LinkDB All DBs
Position
complement(2020673..2021752)
Genome map
AA seq 359 aa AA seqDB search
MDLPLLPPVKPMLAKAVTKVPTAEGMFYEPKWDGFRCIVFRDGDEVELGSRNERPLTRYF
PEVVEAVKAALPERCVVDGEIVVPNGDRLHFEALLQRIHPAESRIRLLAEQTPASFVAFD
LLAIGDESLMETPFAQRRARLQEVVTGTDSVHVTAITQDPDTAQRWFQEFEGAGLDGVVA
KPADLPYGPDQRLMTKVKHVRTADCVVAGFRWHKSGPIVGSLLLGLYDDSGDLQHIGVAA
SFPMARRAELVEELAPYRAEALDGHPWQDWANAQVVNGSNGDEHRMPGAQSRWNAGKDLS
WVPMRPELVVEVKYDQLEGRRLRHTGQFLRWRPDREARSCTYDQLEVPVRYDLAEVFDG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccctgctgccgccggtgaagccgatgctggccaaggccgtgaccaaggtg
cccaccgccgagggcatgttctacgagccgaagtgggacggcttccggtgcatcgtcttc
cgggacggcgacgaggtggagctgggcagccgcaacgagcgcccgctgacccgctacttc
cccgaggtggtcgaggcggtcaaggcggcgctgcccgagcgctgtgtggtcgacggcgag
atcgtcgtccccaacggcgaccggctgcacttcgaggcgctgctgcagcgcatccacccg
gccgagtcccgcatccggctgctcgcggagcagacgccggcctccttcgtcgccttcgac
ctgctcgcgatcggggacgagtcgctgatggagaccccgttcgcgcagcggcgggcccgg
ctgcaggaggtcgtgaccggcacggactcggtgcacgtcaccgcgatcacccaggacccc
gacaccgcacagcgctggttccaggagttcgagggcgccggtctggacggcgtcgtggcc
aagcccgccgacctgccgtacggccccgaccagcggttgatgaccaaggtcaagcacgtg
cgcacggcggactgcgtggtggccgggttccgctggcacaagagcgggccgatcgtcggg
tcgctgctgctgggcctctacgacgactccggcgacctgcagcacatcggcgtcgcggcg
tcgttcccgatggcccggcgggccgagctggtcgaggagctggcgccctaccgggccgag
gcgctggacgggcacccgtggcaggactgggcgaacgcgcaggtcgtcaacggcagcaac
ggcgacgagcaccggatgcccggcgcgcagagccgctggaacgccggcaaggacctctcc
tgggtgccgatgcgccccgagctcgtggtggaggtcaagtacgaccagctggagggacgg
cggctgcggcacaccggccagttcctgcgctggcgccccgaccgggaggcgcgcagctgc
acctacgaccagctggaggtgccggtgcgctacgacctggcggaggtcttcgacggctga

DBGET integrated database retrieval system