KEGG   Geodermatophilus obscurus: Gobs_2120Help
Entry
Gobs_2120         CDS       T01163                                 

Definition
(GenBank) DNA polymerase LigD, ligase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
gob  Geodermatophilus obscurus
Pathway
gob03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:gob00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Gobs_2120
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gob03400]
    Gobs_2120
Enzymes [BR:gob01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Gobs_2120
DNA repair and recombination proteins [BR:gob03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Gobs_2120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C LigD_N RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ADB74805
UniProt: D2SFQ0
LinkDB All DBs
Position
2204759..2206069
Genome map
AA seq 436 aa AA seqDB search
MPTRGSARRPTPPAGEPFVVTEHPSSGAELRLERNGVPCCWDLPEGPPAARGRALPAVPT
MGGDGGGLPTWDAGRYAVEQWTDDRVVVVLAGRRLRGRHVLFRSPDGGWSVRALDAPAEG
APLVPMLATAGELPPSAQDHDWGYEFKWDGVRALAVVEAGGLALWARSGTDITVRYPELS
LPTALTGHDAVVDGEVVALDARGRPDFGALQGRMHRTGPEVRRMAATTPVTYLVFDLLAW
EGESLLALPYAQRRERLEALGVAGERWVPTPWFRGGGAAVLAASRDNGLEGIVAKRLDSP
YRPGLRGPDWRKVKNVRTQAVVVGGWRPGQGRRAGGVGSLLVGVHDDAGRLVYAGHVGTG
FTAAALAELQPLFTPAHRPPFADALPREVTRDARWVAPELVGEVAFAAWTADGRMRHPSW
RGLRDDLAPEDVVEEW
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
gtgccgacccgggggagcgcccggcggcccaccccgccggccggggagccgttcgtcgtc
accgagcacccgtccagcggcgccgagctgcggctggagcggaacggcgtgccgtgctgc
tgggacctgccggaggggccacccgccgcgcggggccgggcgctgcccgccgtccccacc
atgggtggggacgggggcgggctgccgacctgggacgccggccgctacgccgtcgagcag
tggaccgacgaccgcgtcgtcgtggtcctcgccgggcggcggctgcggggccggcacgtc
ctcttccggtcgcccgacggcggctggtccgtccgcgcgctggacgccccggcggagggg
gcgcccctggtcccgatgctcgccaccgcgggggagctgccgccgtccgcgcaggaccac
gactggggctacgaattcaagtgggacggcgtccgggcgctggccgtcgtcgaggccggc
gggctcgcgctctgggcccgcagcggcaccgacatcaccgtccgttatcccgaactgagc
cttccgacagccctgaccggccacgacgccgtcgtcgacggggaagtggtcgccctcgac
gcgcgcggcaggccggacttcggcgcgcttcaggggcggatgcaccgcaccggccccgag
gtgcgccggatggccgcgaccaccccggtgacctacctggtgttcgacctgctcgcgtgg
gagggcgagagcctgctcgcgctgccgtacgcgcaacgccgcgagcggctggaggcgctg
ggcgtcgccggcgagcggtgggtgcccacgccctggttccgcggcggtggagccgcggtg
ctggccgccagccgcgacaacggactggaggggatcgtcgccaagcggctggactcgccg
taccgccccggcctccgggggccggactggcgcaaggtgaagaacgtccggacgcaggcg
gtcgtcgtcggcggctggcggcccgggcagggccggcgggcggggggagtggggtcgctg
ctcgtgggggtgcacgacgacgccggacggctggtctacgccgggcacgtcggcaccggc
ttcaccgccgcggccctcgcggagctccagccgctcttcacgccggcccaccgcccgccg
ttcgccgacgcactgccccgcgaggtcacccgcgacgcgcgctgggtggcgccggagctg
gtcggcgaggtggcgttcgccgcgtggaccgccgacggccggatgcgccacccgtcgtgg
cgagggctgcgcgacgacctggcgccggaggacgtggtcgaggagtggtga

DBGET integrated database retrieval system