KEGG   Geodermatophilus obscurus: Gobs_2121Help
Entry
Gobs_2121         CDS       T01163                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
gob  Geodermatophilus obscurus
Pathway
gob03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:gob00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Gobs_2121
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gob03400]
    Gobs_2121
Enzymes [BR:gob01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Gobs_2121
DNA repair and recombination proteins [BR:gob03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Gobs_2121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADB74806
UniProt: D2SFQ1
LinkDB All DBs
Position
2206095..2207015
Genome map
AA seq 306 aa AA seqDB search
MSRQLVRVDGRQLHVSNLEKVLFPEVSFTKAQVIDYYVRIAPVLLPHLSGRPVTFSRWPD
GVEGQAFFEKNSARHAPDWVRKVTVPSPGSSRGRETLDMVILETVADLAWAANLAALELH
VPQWQVGSRLQPALPDLLVLDLDPGPDAGILECCEVADRLREWLVDDGLDPVVKTSGSKG
MQVYAPIRVTDREHPSRYAKALAQQLSAETPDRVVWRMEKVLRPGKVLIDWSQNNPAKTT
VAPYSLRARPDATVSTPIGWDEVEAVLDGADPGALRFRTEDVLARVEDYGDLFDIAGAQR
AVLPSA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgagccggcagctggtgcgcgtggacgggcggcagctgcacgtgtccaacctggagaag
gtcctcttccccgaggtgtccttcaccaaggcccaggtcatcgactactacgtgcggatc
gcgccggtgctgctgccgcacctgtccggccggccggtgaccttctcccggtggcccgac
ggggtcgagggtcaggcgttcttcgagaagaacagcgcccggcacgcccccgactgggtg
cggaaggtgaccgtgcccagccccggcagctcgcgggggcgcgagaccctcgacatggtc
atcctcgagaccgtcgccgacctcgcgtgggcggccaacctggccgccctggagctgcac
gtgccgcagtggcaggtcggcagccggctgcagccggcgctgccggacctgctcgtgctc
gacctcgaccccggtccggacgccggcatcctcgagtgctgcgaggtcgccgaccggctg
cgcgagtggctggtcgacgacggcctggaccccgtggtcaagacgtcggggtccaagggc
atgcaggtgtacgcgccgatccgggtgaccgaccgcgagcaccccagccggtacgccaag
gcgctggcgcagcagctgtcggccgagacgcccgaccgcgtggtgtggcggatggagaag
gtgctgcggccgggcaaggtgctcatcgactggagccagaacaacccggccaagacgacg
gtcgccccgtactcgctgcgcgcccggcccgacgcgacggtgtccaccccgatcggctgg
gacgaggtcgaggccgtgctcgacggcgccgaccccggcgcgctgcgcttccgcaccgag
gacgtgctggcccgggtcgaggactacggcgacctgttcgacatcgccggggcgcagcgc
gccgtcctgccctcggcgtga

DBGET integrated database retrieval system