KEGG   Geodermatophilus obscurus: Gobs_4044Help
Entry
Gobs_4044         CDS       T01163                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00473  D-Alanine metabolism
gob00550  Peptidoglycan biosynthesis
gob01100  Metabolic pathways
gob01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Gobs_4044
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Gobs_4044
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Gobs_4044
Enzymes [BR:gob01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Gobs_4044
Peptidoglycan biosynthesis and degradation proteins [BR:gob01011]
 Precursor biosynthesis
  Amino acid ligase
   Gobs_4044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ADB76609
UniProt: D2SEH3
LinkDB All DBs
Position
complement(4239604..4240758)
Genome map
AA seq 384 aa AA seqDB search
MSGQAGKLRIAVVFGGRSAEHSISCVSAGAVLAGLDPDRYDVVPVGIARDGRWVLAEPAQ
RLAIADGELPEVTGGTAVSLVGDPGGRGLAVLEPAAGVASALTEVDVVFPVLHGAYGEDG
TIQGLLEMSGIPYVGSGVFASAASMDKEFTKKLLAAAGLPQGVHVVLRDASGAVSADPGV
LDDADRERLGLPVFVKPCRAGSSIGITKVTDWAQFPEAVATAASVDPKVIVEAAVPGREV
ECGVLARPDGPPQASLPAEIRLRPGTEWYDFAAKYLDDAVDFDVPADLTPEQTRLVQETA
RKAFLALDCRGLARVDFFLGTGPDGADRLVVNEVNTMPGFTPISMYPRMWAATGVDFAAL
VDRLVEVALAARPAAEATLDGTRA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagcggacaggcgggcaagctgcggatcgcggtcgtcttcggcggccgcagcgcggaa
cactccatctcctgcgtctccgccggggccgtcctcgcggggctggaccccgaccggtac
gacgtcgtccccgtgggaatcgcccgcgacggccgctgggtgctcgccgagccggcgcag
cgcctggcgatcgccgatggcgagctgccggaggtcacgggcgggacggcggtctcgttg
gtgggcgatccggggggacgggggctggccgtcctcgagccggccgccggcgtggcctcc
gcgctgaccgaggtggacgtcgtcttcccggtgctgcacggcgcgtacggcgaggacggc
accatccagggcctgctggagatgagcggcatcccgtacgtgggctcgggcgtcttcgcc
agcgcggcgtcgatggacaaggagttcaccaagaagctgctggcggcggccggactgccg
cagggcgtccacgtcgtcctgcgggacgcgtcgggcgcggtgtcggccgatcccggcgtg
ctcgacgacgcggaccgcgagcggctgggcctgccggtgttcgtgaagccctgccgcgcc
gggtccagcatcgggatcaccaaggtgaccgactgggcgcagttccccgaggcggtggcg
accgccgcctcggtcgaccccaaggtgatcgtggaggccgccgtccccggacgggaggtg
gagtgcggcgtgctcgcccggccggacgggcccccgcaggccagcctcccggccgagatc
cggctgcgcccgggcaccgagtggtacgacttcgccgccaagtacctcgatgacgcggtc
gacttcgacgtgcccgccgacctcacccctgagcagacccggctggtgcaggagaccgcg
cgcaaggcgttcctggcgctggactgccgcggcctggcgcgggtcgacttcttcctcggc
accggcccggacggcgccgatcggctcgtggtcaacgaggtcaacaccatgcccgggttc
accccgatctcgatgtatccgcggatgtgggcggcgaccggcgtcgacttcgccgcgctg
gtggaccggctcgtcgaggtcgccctggccgcccgcccggctgccgaggcgacgctggac
ggcacccgggcgtga

DBGET integrated database retrieval system