KEGG   Geodermatophilus obscurus: Gobs_4176Help
Entry
Gobs_4176         CDS       T01163                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
gob  Geodermatophilus obscurus
Brite
KEGG Orthology (KO) [BR:gob00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Gobs_4176
Enzymes [BR:gob01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Gobs_4176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni Phage_clamp_A DUF2937
Motif
Other DBs
NCBI-ProteinID: ADB76739
UniProt: D2SF85
LinkDB All DBs
Position
4391574..4391975
Genome map
AA seq 133 aa AA seqDB search
MRFGMFSAVAATAHCDVPCGVYDPAQARIEAESVKAIQEKYQANEDPVFRTRAIMIKDQR
AELVKHHLWVLWTDYFKAPHFEKYPQLHELFNKATKQAGASGARGSMDPAEGQKLLDYIA
EIDKIFWETKAAA
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttcggcatgttctccgccgtggcggcgaccgctcactgcgatgtcccctgcggc
gtgtacgacccggcccaggcccgcatcgaggcggagtccgtcaaggccatccaggagaag
taccaggccaacgaggacccggtcttccgcacccgcgcgatcatgatcaaggaccagcgc
gccgagctggtcaagcaccacctgtgggtgctgtggaccgactacttcaaggcgccgcac
ttcgagaagtacccgcagctgcacgagttgttcaacaaggccaccaagcaggccggcgcc
tcgggggcccggggcagcatggacccggccgagggccagaagctgctcgactacatcgcc
gagatcgacaagatcttctgggagacgaaggccgccgcctga

DBGET integrated database retrieval system