KEGG   Geodermatophilus obscurus: Gobs_4413Help
Entry
Gobs_4413         CDS       T01163                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00020  Citrate cycle (TCA cycle)
gob00480  Glutathione metabolism
gob01100  Metabolic pathways
gob01110  Biosynthesis of secondary metabolites
gob01120  Microbial metabolism in diverse environments
gob01130  Biosynthesis of antibiotics
gob01200  Carbon metabolism
gob01210  2-Oxocarboxylic acid metabolism
gob01230  Biosynthesis of amino acids
Module
gob_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gob_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:gob00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Gobs_4413
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Gobs_4413
Enzymes [BR:gob01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Gobs_4413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: ADB76967
UniProt: D2SG99
LinkDB All DBs
Position
complement(4647564..4648778)
Genome map
AA seq 404 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWQFIKDQLILPYLDVDLEYYDLGIEKRDETDDQITVDA
AEAIKRHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVIFREPIIMQNVPRL
VPGWTKPIVVGRHAFGDQYRATDFRFPGEGTLTITFQPKDGGEPIQHEVFQSPGGGVAMA
MYNLDESIRDFARASMNYGLQRGYPVYLSTKNTILKAYDGRFKDLFAEVFESEFKDQFEQ
AGITYEHRLIDDMVAASLKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMSPDGR
TVEAEAAHGTVTRHFRQHQQGKETSTNPIASIFAWTRGLAHRGKLDNTPEVTRFAETLEK
VCIDTVESGQMTKDLALLISKDQPWLSTQDFLAAIDGNLQKAMA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaagatcaaggtcgagggcaccgtcgtcgagctcgacggcgacgagatgacccgg
atcatctggcagttcatcaaggaccagctgatcctcccgtacctcgacgtcgacctcgag
tactacgacctgggcatcgagaagcgcgacgagaccgacgaccagatcaccgtcgacgcg
gccgaggccatcaagcgccacggcgtcggcgtcaagtgcgcgacgatcactcctgacgag
gcccgcgtcgaggagttcggtctcaagaagatgtggcggtccccgaacgggacgatccgc
aacatcctcggcggtgtgatcttccgcgagccgatcatcatgcagaacgtgccgcggctg
gtgccgggctggaccaagccgatcgtcgtcggccgtcacgccttcggtgaccagtaccgg
gccacggacttcaggttccccggtgagggcacgctgacgatcaccttccagcccaaggac
ggcggcgagccgatccagcacgaggtgttccagtcccccggcgggggcgtcgcgatggcg
atgtacaacctcgacgagtcgatccgcgacttcgcccgggcctcgatgaactacggcctg
cagcgcggctacccggtctacctctcgaccaagaacacgatcctcaaggcctacgacggg
cggttcaaggacctgttcgccgaggtcttcgagtccgagttcaaggaccagttcgagcag
gccgggatcacctacgagcaccggctcatcgacgacatggtggcggcgtccctcaagtgg
gagggcggttacgtctgggcctgcaagaactacgacggcgatgtccagtccgacaccgtg
gcccagggcttcggctcgctgggcctgatgacctcggtgctgatgagccccgacggccgc
accgtcgaggccgaggccgcccacggcacggtgacccggcacttccggcagcaccagcag
ggcaaggagacctcgaccaacccgatcgcgtcgatcttcgcctggacccggggcctggcc
caccgcggcaagcttgacaacacgcccgaggtgacccgcttcgcggagaccctggagaag
gtctgcatcgacaccgtcgagagcggccagatgaccaaggacctcgccctgctgatcagc
aaggaccagccgtggctctccacccaggacttcctggcggccatcgacgggaacctgcag
aaggccatggcctga

DBGET integrated database retrieval system