KEGG   Geodermatophilus obscurus: Gobs_5088Help
Entry
Gobs_5088         CDS       T01163                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00473  D-Alanine metabolism
gob00550  Peptidoglycan biosynthesis
gob01100  Metabolic pathways
gob01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gob00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Gobs_5088
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Gobs_5088
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Gobs_5088
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gob01011]
    Gobs_5088
Enzymes [BR:gob01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Gobs_5088
Peptidoglycan biosynthesis and degradation proteins [BR:gob01011]
 Precursor biosynthesis
  Amino acid ligase
   Gobs_5088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 CPSase_L_D2 ATP-grasp_4 RimK
Motif
Other DBs
NCBI-ProteinID: ADB77615
UniProt: D2S835
LinkDB All DBs
Position
5315432..5316421
Genome map
AA seq 329 aa AA seqDB search
MTEPAPATESEAAPHALRAVVLAGGLNVEREVSLSSGTQVAEELARAGVEAELRDADAEL
LPGLAAAPADAVFIALHGATGEDGALRAVLDLAGVPYVGSPAASCRLAWDKPAAKSVVRS
AGVTTPDWVALPHSTFRELGAGAVLDLIVARLGLPLMVKPASGGSALGVQKVSRVEDLPA
AMVSCFAYGDTVMVERFVDGVELALSVVDLGEGPQALPAVEIAPESGVFDYTSRYTPGLT
EYHAPARVSDEVAGKAAELAVQVHRALGLADLSRTDAIVGPDGEVHFLEVNVSPGLTRTS
MFPMAVEASGSSLGDVLAGLLTRRASTTR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagcccgcacccgcgaccgagtcggaggccgcgccgcacgcgctgcgcgccgtc
gtcctggccggtgggctgaacgtcgagcgggaggtcagcctctcctccggcacccaggtg
gccgaggagctcgcccgcgccggcgtggaggccgagctgcgtgacgccgacgccgagctg
ctgcccgggctcgccgccgcccccgcggacgccgtcttcatcgccctgcacggcgccacg
ggcgaggacggcgcgctgcgggcggtcctggacctggccggcgtcccctacgtcggctcc
ccggcggcgtcctgccggctggcctgggacaagccggccgcgaagtccgtcgtccgctcc
gccggcgtcaccacgccggactgggtggccctgccgcacagcaccttccgggagctgggc
gccggtgcggtgctggacctcatcgtcgcccgcctcggcctgccactcatggtcaagccc
gcctcgggcggctccgcgctgggcgtgcagaaggtcagccgggtcgaggacctgccggcc
gcgatggtcagctgcttcgcctacggcgacacggtcatggtggagcgcttcgtggacggc
gtggagctggcgctgtccgtggtggacctcggcgagggcccgcaggcgctcccggcggtg
gagatcgccccggagtcgggggtgttcgactacacctcccgctacacgcccggcctcacc
gagtaccacgcaccggcccgcgtctccgacgaggtggccgggaaggccgcagagctcgcc
gtccaggtgcaccgggccctcggcctcgccgacctctcccgcaccgacgcgatcgtcggc
ccggacggcgaggtgcacttcctcgaggtgaacgtctcgcccgggctgacccgcacctcg
atgttcccgatggccgtcgaggcgtccggctcctcgctgggcgacgtcctcgccgggctg
ctgacccggcgggcctccaccactcgctga

DBGET integrated database retrieval system