KEGG   Gordonia sp. YC-JH1: CXX93_04190Help
Entry
CXX93_04190       CDS       T05256                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
goc  Gordonia sp. YC-JH1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AUH70116
LinkDB All DBs
Position
906446..907498
Genome map
AA seq 350 aa AA seqDB search
MDLPVNPPVQPMLAKAVTAVPDQPGGEPVWSYEPKWDGFRALIFRDGDEVVMSSRGGKDL
ARYFPELVDAAHAVLPERVVLDGEVAVARPIGGVNRLDWDSLSQRIHPAASRVARLAEET
PAVFIGFDALATDSMDLTAERFEVRRSALLDAAAESGDDRIQVSRVTRDSAVATDWFTAF
EGAGLDGVVGKRLDGVYVPGKREMVKVKHKRTADCVVIGYRIHKSGTGLGSMLLGLYAEG
ELRMVGGSSAFSDKKRIELQEMLEPMRLDPDRVAQGEVSRWRAAGSGEWIPIRPELVAEF
AYDQMENQRFRHTVKFLRWRPDREPESCGYDQLDVPLTYDVFDVLVTGGQ
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtggacctcccggtgaacccgcccgtgcaaccgatgctggccaaggcggtcaccgccgtg
cccgaccaacccggcggcgagccggtgtggtcgtacgaacccaagtgggacggcttccgg
gccttgatcttccgggacggagacgaggtcgtgatgtcctcgcggggcggcaaggatctg
gcccgctattttccggagctggtcgacgcggcgcatgcggtgcttcccgagcgggtggtc
ctcgacggcgaggtcgccgtcgcccggcccatcggcggggtgaaccggctcgactgggat
tcgctctcgcaacgcatccaccccgcggcgtcgcgcgtggcgagactggcggaggagaca
ccggccgtgttcatcggcttcgacgccctggccaccgactcgatggacctgacggcggag
cgattcgaggtccggcgcagcgcgctgctggacgccgctgccgaatccggagacgaccgc
atccaggtcagccgcgtcacccgggactcggcggtcgcgaccgactggttcaccgcgttc
gagggcgccgggctcgacggcgtcgtgggcaagcggctcgacggcgtctacgtcccgggg
aaacgggagatggtcaaggtcaagcacaagcgcaccgccgactgcgtggtgatcgggtat
cgcattcacaagtcgggcaccggactcgggtcgatgctgctcgggctgtacgccgagggg
gaactgcggatggtcggcggttccagtgcgttctccgacaagaagcggatcgaactgcag
gagatgctcgagccgatgcggctcgatccggatcgcgtcgcacaaggcgaggtgagccgc
tggcgcgcggccggcagcggcgagtggattccgatccggccggagctggtggccgagttc
gcctacgaccagatggagaatcagcgattccggcacacggtgaagttcctccggtggcgc
cccgaccgggaaccggagagctgtggctacgaccagctcgacgtgcccctgacctacgac
gtcttcgacgttctcgtgaccggaggacagtga

DBGET integrated database retrieval system