KEGG   Gordonia sp. YC-JH1: CXX93_11145Help
Entry
CXX93_11145       CDS       T05256                                 

Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
goc  Gordonia sp. YC-JH1
Pathway
goc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
goc01100  Metabolic pathways
goc01110  Biosynthesis of secondary metabolites
goc01130  Biosynthesis of antibiotics
goc01230  Biosynthesis of amino acids
goc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:goc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CXX93_11145
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    CXX93_11145
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CXX93_11145
Enzymes [BR:goc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     CXX93_11145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AUH70279
LinkDB All DBs
Position
2386967..2388529
Genome map
AA seq 520 aa AA seqDB search
MSTADNSASTTPLATFLDLARDHRVVPVTRKVLADSETPLSAFRKLAAEPGAGGGLREGT
FLLESAPNGASWSRWSFIGAGTRSALTVADGQAHWWGDVPAGAPVGGDPVAALDESLRLL
QTDPLDGMPPLTGGFVGFMAYDFVRRLERLPEQTVDDLRLPDMFWLLVADLAAFDHHEGT
ITLIANAVNWDGSDERAEEAYHDAVARLDAMTRALAAPAPSTVSTFDRPAPDYRSQRTLD
DYREIVEGLVGQIEAGEAFQVVPSMRFEIDTDADPLDVYRVLRASNPSPYMYLLRMPGVD
REPFTIVGSSPEALVTVTDRVATTHPIAGTRWRGATEAEDQLLAKGLLEDEKENSEHLML
VDLGRNDLGRVCEPGTVRVTDYRRVERYSHVMHLVSTVSGTLRDDKQALDAVTACFPAGT
LTGAPKVRAMELIEANEITRRGLYGGVVGYLDFAGNADTAIAIRTALMSGRTAYVQAGGG
VVADSDAKYEFNEARNKASAVLAAVAAAGTMRPVAGEETP
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgcagacaactccgcgagcacgaccccgctcgccaccttcctcgatctggcg
cgcgaccaccgagtggtcccggtgacccgcaaggtcctcgccgactccgagacaccgctg
tcggcgttccggaagctggcagccgagccgggggccggcggcggtctccgcgaaggcacc
ttcctgctcgaatccgcgccgaacggcgcctcgtggtcgcgctggtcgttcatcggcgcg
ggcacccgttcggccctgaccgtcgccgacgggcaggcgcactggtggggcgacgtcccc
gcgggagctccggtgggcggcgatccggttgcggcgctcgacgagtcgttgcggctgctg
cagaccgatccgctcgacgggatgccgccgctgaccggcggcttcgtcggcttcatggcc
tacgacttcgtgcgccgcctggagcggcttccggaacagacggtcgacgacctgcggctc
cccgacatgttctggctgctggtggccgatctcgccgccttcgaccaccacgagggcacg
atcaccctgatcgcgaacgccgtgaactgggacggcagcgacgagcgcgccgaagaggcc
taccacgacgccgtcgcgcggctggatgcgatgacccgggcgctggccgccccggctccc
tccaccgtctcgaccttcgacaggcccgcgcccgactaccgctcgcagcgcacgctggac
gactaccgcgagatcgtcgagggtctggtcggacagatcgaggcgggtgaggcgttccag
gtggtgccgtcgatgcgcttcgagatcgacaccgacgccgatccgctcgacgtgtaccgc
gtcctgcgcgcgtcgaatccgagcccgtacatgtacctgcttcggatgccgggcgtcgac
cgggagccgttcacgatcgtcggatcctcgcccgaggcactggtcaccgtcaccgatcgg
gtggccaccacacacccgatcgcgggcacgcgctggcgcggtgccaccgaggcggaggac
cagttgctcgcgaagggcctgctcgaggacgagaaggagaactccgagcatctgatgctg
gtcgacctgggccgcaacgatctgggccgggtatgcgagccgggcactgtccgcgtcacg
gactaccgccgagtggagcgctacagccacgtgatgcacctggtgtccacggtctccgga
actcttcgcgacgacaagcaggcgctcgatgcggtgaccgcctgcttcccggcgggaacc
ctcaccggggcaccgaaggtccgggcgatggaattgatcgaggccaacgagatcacccgc
cgcggactgtacgggggcgtcgtcggatatctcgatttcgcaggcaacgccgacaccgcg
atcgcgatccggacggcactgatgtccggccgcactgcctacgtccaggccggcggcgga
gtcgtcgccgacagcgacgccaagtacgagttcaacgaggcgcgcaacaaggcgtcggcg
gtgctcgccgcagtagccgccgccggcaccatgcgcccggtggcgggggaggagacccca
tga

DBGET integrated database retrieval system