KEGG   Gordonia sp. YC-JH1: CXX93_16115Help
Entry
CXX93_16115       CDS       T05256                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
goc  Gordonia sp. YC-JH1
Pathway
goc00020  Citrate cycle (TCA cycle)
goc00190  Oxidative phosphorylation
goc00650  Butanoate metabolism
goc01100  Metabolic pathways
goc01110  Biosynthesis of secondary metabolites
goc01120  Microbial metabolism in diverse environments
goc01130  Biosynthesis of antibiotics
goc01200  Carbon metabolism
Module
goc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:goc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CXX93_16115
   00650 Butanoate metabolism
    CXX93_16115
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CXX93_16115
Enzymes [BR:goc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CXX93_16115
    1.3.5.4  fumarate reductase (quinol)
     CXX93_16115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 DAO HI0933_like FAD_oxidored GIDA
Motif
Other DBs
NCBI-ProteinID: AUH69572
LinkDB All DBs
Position
3468735..3470489
Genome map
AA seq 584 aa AA seqDB search
MQEHRYDVVIVGAGGAGMRAAIEAAPRARTAVLTKLYPTRSHTGAAQGGMCAALANVEED
NWEWHTFDTVKGGDYIVDQDAAEIMAKEAIDAVLDLEKMGLPFNRTPEGRIDQRRFGGHT
RDHGKAPVRRACYAADRTGHMILQTLYQNCVKHDVEFFNEFYALDVNMTTDENGEPVANG
VVAYELATGEIHVFHAKSIVFATGGSGRMYKTTSNAHTLTGDGMGIIFRKGLPLEDMEFH
QFHPTGLAGLGILISEAVRGEGGILRNADGERFMERYAPTIKDLAPRDIVARSMVLEVLE
GRGAGPNKDYVYIDVRHLGEDVLNEKLPDITEFSRTYLGVDPVTELVPVYPTCHYVMGGI
PTNVRGQVLANNEQIVHGLFAAGECACVSVHGANRLGTNSLLDINVFGRRAGIAAAEYAN
STDFTEQVENPTAMVDGWLAGLLSEHGNERVADIRTELQQTMDNNASVFRTDETLNKALA
DVRALKERYNHIRVHDKGKRFNSDLLEAVELGFLLELAEVTVAGALNRKESRGGHAREDF
PKRDDENYLVHTMAYKKGDGLLADIELDYKPVVQTRYEPMERKY
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaacaccgctatgacgtggtcatcgtcggcgccggcggcgccggtatgcgcgct
gccatcgaggccgcaccgcgggcccgcaccgcagtcctgaccaagctctaccccacccgc
tcgcacaccggcgcggcacagggcggcatgtgcgccgctctggccaacgtcgaagaggac
aactgggagtggcacaccttcgacacggtcaagggcggcgactacatcgtcgaccaggac
gccgctgagatcatggccaaggaggccatcgacgcggtgctcgacctggagaagatgggt
ctgccgttcaaccgcacccccgagggccgcatcgaccagcgccgcttcggcggtcacacc
cgcgaccacggcaaggcgccggtccgccgcgcctgctacgccgcggaccgcaccggtcac
atgatccttcagaccctgtaccagaactgcgtcaagcacgacgtcgagttcttcaacgag
ttctacgctctggacgtcaacatgacgaccgacgagaacggcgagcccgtcgccaacggt
gtcgtcgcgtacgagttggccaccggcgagatccacgtcttccacgccaagtcgatcgtc
ttcgccaccggcggttcgggtcgcatgtacaagaccacgtccaatgcgcacacgctcacc
ggcgacggcatgggcatcatcttccgcaagggcctgccgctggaggacatggagttccac
cagttccatccgacgggtctggccggtctgggcatcctgatctccgaggcggtccgaggc
gagggcggcatcctccgcaacgccgacggcgaacgcttcatggagcggtacgcacccacg
atcaaggacctcgccccgcgtgacatcgtcgcccggtcgatggtgctcgaggtgctcgaa
ggccgcggcgccggacccaacaaggactacgtctacatcgacgtgcgtcacctgggcgag
gacgtgctcaacgagaagctcccggacatcaccgagttctcgcgcacctacctgggcgtg
gacccggtcaccgagttggtcccggtgtaccccacctgccactacgtgatgggcggcatc
ccgaccaacgtccgcggccaggtgctcgcgaacaacgagcagatcgttcacggtctgttc
gccgccggcgagtgcgcctgcgtgtcggtccacggcgcgaaccgcctgggcaccaactcg
ctcctcgacatcaacgtcttcggtcgccgcgccggaatcgccgctgccgagtacgccaac
tccaccgacttcaccgagcaggtggagaacccgacggcgatggtcgacggctggctcgcc
ggcctgctgtccgagcacggcaacgagcgcgtggccgacatccgcaccgaactgcagcag
accatggacaacaacgcgtccgtgttccgcaccgacgagaccctgaacaaggcgctcgcc
gatgtccgcgcactcaaggagcggtacaaccacatccgcgtccacgacaagggcaagcgc
ttcaacagcgatctgctcgaggccgtcgagctgggcttcctgctcgaactggccgaggtc
accgtcgccggtgcgctcaaccgcaaggagtcgcgcggcggtcacgcccgcgaggacttc
ccgaagcgcgacgacgagaactacctggtgcacaccatggcgtacaagaagggcgacggc
ctgctcgccgacatcgagctcgactacaagcccgtcgttcagacccgctacgagccgatg
gagcgtaagtactga

DBGET integrated database retrieval system