KEGG   Gordonia sp. YC-JH1: CXX93_16120Help
Entry
CXX93_16120       CDS       T05256                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
goc  Gordonia sp. YC-JH1
Pathway
goc00020  Citrate cycle (TCA cycle)
goc00190  Oxidative phosphorylation
goc00650  Butanoate metabolism
goc01100  Metabolic pathways
goc01110  Biosynthesis of secondary metabolites
goc01120  Microbial metabolism in diverse environments
goc01130  Biosynthesis of antibiotics
goc01200  Carbon metabolism
Module
goc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:goc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CXX93_16120
   00650 Butanoate metabolism
    CXX93_16120
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CXX93_16120
Enzymes [BR:goc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CXX93_16120
    1.3.5.4  fumarate reductase (quinol)
     CXX93_16120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_18 Fer4_4 Fer4 Fer4_7 Fer4_16 Fer4_2
Motif
Other DBs
NCBI-ProteinID: AUH69573
LinkDB All DBs
Position
3470489..3471274
Genome map
AA seq 261 aa AA seqDB search
MTATLESTPATNEPPLPPVPAEATMVTLKIYRFNPENPDAQGFESFRVPALPTDRLLNLL
LYVKGYLDGSLTFRRSCAHGVCGSDAMRINGVNRLACKLLMKDLLPKDSSKEITITIEPI
KGLPVEKDLVVDMEPFFDAYRAIKPFLITSGNEPTYERIQSQADRARFDDTTKCILCACC
TTSCPVFWNEGSYFGPAAIVNAHRFIFDSRDEGAAERLDILNDVDGVWRCRTTFNCTDAC
PRGIQVTQAIQEVKRALMFAR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgactgccacactcgaatccaccccggcgaccaatgagcccccgctgcctccggttccg
gccgaggcgacgatggtcacgctgaagatctaccggttcaacccggagaacccggacgcc
cagggcttcgagagcttccgtgtcccggcgctgccgaccgaccgcctgctcaacctgctc
ctgtacgtcaagggttacctggacggctcgctgaccttccgccgcagctgcgcccacggc
gtctgcggttcggacgcgatgcggatcaacggcgtcaaccggctggcctgcaagctcctc
atgaaggatctgctgccgaaggactcgtccaaggagatcaccatcaccatcgagcccatc
aagggcctcccggtggagaaggacctcgtggtcgacatggagccgttcttcgacgcgtac
cgcgccatcaagccgttcctgatcacctcgggcaacgagccgacgtacgagcggatccag
agccaggccgaccgcgcccggttcgacgacaccaccaagtgcatcctgtgtgcgtgctgc
accacgagctgcccggtgttctggaacgagggatcgtacttcggaccggccgcgatcgtg
aacgctcaccggttcatcttcgacagccgtgacgagggcgccgccgagcgtctcgacatc
ctcaacgacgtcgacggtgtgtggcgctgccgcaccaccttcaactgcaccgacgcatgc
ccccgcggcatccaggtgacgcaggcgatccaggaagtcaagcgcgccctgatgttcgcc
cgctag

DBGET integrated database retrieval system