KEGG   Gordonia sp. YC-JH1: CXX93_16160Help
Entry
CXX93_16160       CDS       T05256                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
goc  Gordonia sp. YC-JH1
Pathway
goc00020  Citrate cycle (TCA cycle)
goc00480  Glutathione metabolism
goc01100  Metabolic pathways
goc01110  Biosynthesis of secondary metabolites
goc01120  Microbial metabolism in diverse environments
goc01130  Biosynthesis of antibiotics
goc01200  Carbon metabolism
goc01210  2-Oxocarboxylic acid metabolism
goc01230  Biosynthesis of amino acids
Module
goc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:goc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CXX93_16160
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CXX93_16160
Enzymes [BR:goc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CXX93_16160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AUH69577
LinkDB All DBs
Position
complement(3479180..3480397)
Genome map
AA seq 405 aa AA seqDB search
MGKIKVEGTVVELDGDEMTRIIWQFIKEKLIHPYLDIDLDYYDLGIENRDATDDQVTVDA
AHAIQKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGTIFRAPILISNVPRL
VPGWTKPVVVGRHAFGDQYRATDFKVPSAGTVTITYTPDDGSEPIEHEIVRIPESGGVVM
GMYNFNKSIEDFARASFNYGLQRNYPVYLSTKNTILKAYDGAFKDIFADVFEREFKAEFD
AAGLHYEHRLIDDMVASSLKWEGGYVWACKNYDGDVQSDTVAQGYGSLGLMTSVLMTPDG
QTCEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLDHRGKLDNTPEVREFAEKLE
DVVIKTVESGKMTKDLALLVGGDQAYLTTEEFLGALDDNLQAALR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatcaaggtcgagggcaccgtcgtcgaactcgacggcgacgagatgacgcga
atcatctggcagttcatcaaagagaagctgatccacccctacctcgacatcgatctggac
tactacgacctcgggatcgagaaccgcgacgcgaccgacgatcaggtcaccgtggacgcc
gcgcacgcgattcagaagcacggtgtcggcgtcaagtgcgccaccatcacccccgacgag
gcccgcgtcgaggaattcggtctcaagaagatgtggcgatcgcctaacggcaccattcgg
aacatcctcggcggcaccatcttccgggctccgatcctgatctcgaacgtgcctcggctg
gtacccggctggaccaagccggtggtcgtcgggcgtcacgccttcggcgaccagtaccgc
gccaccgacttcaaggtgccctcggcgggcacggtcaccatcacctacacgcccgacgac
ggaagcgagccgatcgagcacgagatcgtccgaatccccgagtcgggtggcgtcgtgatg
ggcatgtacaacttcaacaagtcgatcgaggacttcgcgcgggcgtcgttcaactacgga
ctgcagcgcaactatccggtgtacctgtccaccaagaacaccatcctcaaggcctacgac
ggcgcgttcaaggacatcttcgccgacgtcttcgagcgtgagttcaaggccgagttcgat
gccgcggggctgcactacgagcaccggctgatcgacgacatggtcgcctcgtcgctcaag
tgggagggcggctacgtctgggcgtgcaagaactacgacggcgacgtccagtcggacacc
gtggcccagggctacggctcgctcggactgatgacctcggttctgatgacacccgacggc
cagacctgtgaggccgaggccgcgcacggcaccgtgacccggcactaccggcagcaccag
cagggcaagccgacgtcgaccaatccgatcgcgtcgatcttcgcctggacgcgtggtctg
gaccaccgcggcaagctcgacaacacccccgaggtgcgcgagttcgcggagaagctcgag
gacgtcgtcatcaagaccgtcgagtcggggaagatgaccaaggacctggcactgctggtc
ggcggcgaccaggcgtacctcaccaccgaggagttcctgggcgccctcgacgacaatctg
caggccgcgctgcggtag

DBGET integrated database retrieval system