KEGG   Gordonia sp. YC-JH1: CXX93_17250
Entry
CXX93_17250       CDS       T05256                                 

Definition
(GenBank) transaldolase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
goc  Gordonia sp. YC-JH1
Pathway
goc01100  Metabolic pathways
goc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:goc00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    CXX93_17250
Enzymes [BR:goc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     CXX93_17250
SSDB
Motif
Pfam: DeoC FMN_dh
Other DBs
NCBI-ProteinID: AUH69738
LinkDB
Position
3738340..3739176
AA seq 278 aa
MRHSAPPRTASLSGKTLRLRRIFSAPTGRALIVPIDHSVTVGPLGRKNHADWTAAMLAEA
GADALVVHKGRARHIDPAHFRELSLIVHLSAGTSLSVDTTSKVLVGSVEEAMALGADAVS
IHVNIGSPTEAQQLNDLGVVSDECARLGIPLLAMMYNRGMAETPGTQSVATLSHLAAIAT
DLGADIVKLDYAGDRASMDAVADSCPLPIVVAGGAYHDDESAIEFGTRVAESSVAGLSFG
RHVFGARNPARVAAALAHVLHTGDPARPLENFGSRTGL
NT seq 837 nt   +upstreamnt  +downstreamnt
atgaggcactcggcaccaccgcgcacagcgtcgctgtccggtaagacgctgcggctgcgc
cggatcttctccgcgccgaccggacgtgcgctgatcgtcccgatcgaccattcggtgacg
gtcggcccactgggtcgcaagaaccacgccgactggaccgccgcgatgctcgccgaggcg
ggcgccgacgcactcgtggtccacaagggccgggcgcgccacatcgatccggctcatttc
cgcgaactgagtctgatcgtgcatctgtccgcgggcacctcgctgtcggtggacaccacc
tcgaaagtcctggtcggttcggtcgaggaggcgatggctctcggagcggacgcggtgagc
atccacgtcaacatcggatcgcccacggaggcgcagcaactcaacgatctcggcgtggtc
agcgacgagtgcgcccggctcggcattccgctcctggccatgatgtacaaccggggaatg
gccgagactccgggaacccagtcggtcgcgacgctgtcgcatctggcggccatcgccacc
gatctcggcgccgacatcgtcaagctcgactacgcgggcgatcgcgcatccatggacgcg
gtcgcggactcctgcccgctgccgatcgttgtggccggcggcgcctatcacgacgacgag
tcggcgatcgagttcggcacccgggtggccgaatcgtcggtggccgggctgagtttcggc
aggcacgtcttcggtgcccggaatccggctcgtgtggccgccgccctcgcccacgtgctg
cacactggcgaccccgcccgtcctctcgaaaactttggctcccgcaccggcctgtga

DBGET integrated database retrieval system