KEGG   Gordonia sp. 135: GKZ92_19320
Entry
GKZ92_19320       CDS       T06305                                 

Definition
(GenBank) aminotransferase class III-fold pyridoxal phosphate-dependent enzyme
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
god  Gordonia sp. 135
Pathway
god00250  Alanine, aspartate and glutamate metabolism
god00410  beta-Alanine metabolism
god00640  Propanoate metabolism
god00650  Butanoate metabolism
god01100  Metabolic pathways
god01120  Microbial metabolism in diverse environments
Module
god_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:god00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    GKZ92_19320
   00650 Butanoate metabolism
    GKZ92_19320
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GKZ92_19320
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GKZ92_19320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:god01007]
    GKZ92_19320
Enzymes [BR:god01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     GKZ92_19320
Amino acid related enzymes [BR:god01007]
 Aminotransferase (transaminase)
  Class III
   GKZ92_19320
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-ProteinID: QGP89599
UniProt: A0A6I5ZIZ2
LinkDB
Position
4269728..4271035
AA seq 435 aa
MTAGVDSPTRIHQTASLSPALKQATPVVVDHALGSWIHGTDGRDYLDFTTGIGVTSTGHC
HPHVVEAAQAQCAKVIHAQYTTVMHPPLLELTERLGAVLPAGLDSVFYANSGSEAVEAAI
RLARMATAKPNIIVFQGGFHGRTVAAASLTTAGTRFSAGFSPLMGGVHMAPFPYAFRYGW
DTDTAVDFALRELDYLLQSRVAPNDTAAFLIEPVLGDGGYLPTPPRFLQGLRERADRHGI
LLILDEVQAGFGRTGRFWGHQHAEGLTPDIIVTAKGLASGFPISAIAASTELMSKAWPGS
QGGTYGGNAVAAAAAVATLEVIEAEGLVENARVRGEQLLAGLREVCAPFPGVGDVRGLGL
MAGIEFVSTDAAGNRVPDAPAAVAVQQATTEQGLLTLTCGPSANVVRLIPALVVTADEID
LGVARFGAALHAALG
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgactgccggcgttgactcccccacccgcatccaccagacggcctcactcagtcctgcg
ctcaagcaggcgacgccggtcgtcgtcgaccatgcgctggggtcctggatccacggcacc
gacggccgcgactacctcgacttcaccaccggcatcggcgtcaccagcaccggccactgc
cacccgcacgtggtcgaggccgcgcaggcccagtgcgccaaggtgatccacgcccagtac
acgaccgtcatgcacccgccgctgctcgagctgaccgaacgactcggtgcggtcctgccg
gccggcctggactccgtcttctacgccaactcgggttcggaggccgtcgaggccgcgatc
cgccttgcccgcatggcgaccgcgaagccgaacatcatcgtcttccagggcggattccac
ggccgcaccgtcgcggccgcaagcctcaccaccgcgggcacccgcttctcggccggcttc
tccccgctgatgggcggcgtgcacatggcaccgttcccctacgccttccgctacggctgg
gacaccgacaccgcggtcgacttcgcgctgcgggagctcgactacctcctgcagtcgcgc
gtcgcacccaacgacaccgccgcgttcctcatcgagcccgtcctcggcgacggcggctac
ctgccgacgccgccccgattcctccagggcctgcgcgagcgcgccgaccgccacggcatc
ctgctcatcctcgacgaggtgcaggccgggttcggtcgcaccggcagattctggggccac
cagcacgccgagggcctgaccccggacatcatcgtcaccgcaaagggtctggcgtcgggc
ttcccgatctcggcgatcgccgcgtcgaccgagctgatgagcaaggcgtggccgggatcg
cagggcggaacctacggtggcaacgccgtggccgccgcagccgcggtcgcgactctcgag
gtcatcgaggccgagggactcgtggagaacgcccgcgtgcgcggagagcaactgctcgcg
gggcttcgcgaggtgtgcgcgccgttcccgggcgtcggcgacgtccggggcctcggcctg
atggccggcatcgagttcgtctccaccgatgccgccggcaaccgggtgcccgacgccccg
gccgccgtcgcggtgcagcaggccaccacggaacagggcctgttgacgctgacctgcggg
ccgtcggccaacgtcgtccgcctcatcccggcgctggtggtgaccgccgacgagatcgac
ctcggtgtcgcgcggttcggcgcggcgctgcatgccgcactgggttag

DBGET integrated database retrieval system