KEGG   Gemmata obscuriglobus: C1280_01445Help
Entry
C1280_01445       CDS       T05475                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gog  Gemmata obscuriglobus
Pathway
gog00620  Pyruvate metabolism
gog00680  Methane metabolism
gog01100  Metabolic pathways
gog01120  Microbial metabolism in diverse environments
gog01200  Carbon metabolism
Module
gog_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:gog00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C1280_01445
  09102 Energy metabolism
   00680 Methane metabolism
    C1280_01445
Enzymes [BR:gog01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     C1280_01445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AWM35822
UniProt: A0A2Z3GUT5
LinkDB All DBs
Position
complement(346393..349155)
Genome map
AA seq 920 aa AA seqDB search
MQVAAQKALGADIRLLGNLLGQAIRRLGGDAAFDLEEEVRAAAKELRASPSPDAARRLRD
RLGTLDVPALRGLIRAFSVFFDLINLAEQQARVRALRHRAARPDPARAENAESALQSIAR
RGVPVEEVADHLARALVVPVFTAHPSEARRRSVLEKLAAVAQLLDKLEYGQPTPSERDAL
TDAIAEEVEALWLTDAVRSARPSVLDEVRQVLGVVEARLLDVVPKVYRKLESALEKVYPN
HGRRVPAFLQFGSWIGGDRDGHPNVTHAVTAEAVRLQQETVLAHYLQRIEALGGKLSHSA
PFVAAGPSLAASLAADAKLLPGVAQGKPGEPYRAKCLMIAEKLRRTLAFVRTHADDWGAD
AQAPPAGVYVGRGELLADLTLIADDLRRAGATASADGAVRDFIRLVEVFGLHLLTLDIRQ
HSARHEAATAEVLAAAGVCPNYAALSADERFAVLAKELESSRPLVPAHLPFTPDTTEVVR
TFRTMAAVLEQRCPEALGTYIISSTTEPVHLLEVLLFAREARLFRPAEGVSRIDVVPLFE
ALEPLRSARRIVTRLLELPVYRRQVELRGNRQEVMIGYSDSNKESGFLQSAWALYRAQAE
LTELGRGAGVTIQFFHGRGGAVGRGGGPANYAILAQPKGTVDGRIRITEQGEMIADRYGH
PAVAERHLEQVLDAVLRTSFPDAAEGADPKWLAALDALADSARKHYRGLVYEDPGFLTYF
EQATCIGEIAELKIGSRPARRSGARSIEELRAIPWVFSWMQSRHTLPGWFGLGSAVAEFL
RANPDGLAMLSDMYARWPFWRTLIDNSQMILAKADMVIARLYADLVTDQALAARIYGRIE
GEYRAAVDAVCRITGQSALLERSPVLGTSIERRNPYVDPLSFIQLVLLDRLRNQSGPREE
LVTAVLESINGVASGLKNTG
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtggcggcacagaaggcgctcggcgccgacatccggctcctcggcaacctgctc
ggccaagcgatccggcgcctgggaggggacgccgcgttcgacctcgaggaggaggtgcgg
gcggcggccaaggagctgcgcgccagcccctcgccggacgccgcgcggcggctccgcgac
cgcctcggcacgctcgacgtgcccgcgctccgcgggctgatccgggcgttcagcgtgttt
ttcgacctcatcaacctggccgagcagcaggcgcgcgtgcgggcgctgcggcaccgggcc
gcccggccggacccggcccgcgccgagaacgccgagtccgccctccagagcatcgcccgg
cgcggcgtgccggttgaggaggtggcggaccacctcgcccgggcgctggtcgtgcccgtg
ttcaccgcgcacccgagcgaggcccgccgccgctcggtgctggagaagctcgccgcggtg
gcccaactgctcgacaagctcgagtacggccagccgacgccgtccgagcgcgacgcgctg
accgacgcgatcgcggaggaggtcgaggcgctgtggctgacggacgcggtgcggtcggcc
cgcccctccgtgctcgacgaggtgcgccaggtgctcggggtggtcgaggcgcggctgctg
gacgtcgtcccgaaggtgtaccgcaagctcgaatcggcgctcgagaaggtgtacccgaac
cacgggcgccgcgtgccggcgttcttgcagttcgggtcgtggatcggcggcgaccgcgac
ggccaccccaacgtcacccacgccgtcaccgccgaggccgtccggctccagcaggaaacg
gtcctcgcccactacctccagcggatcgaggcgctgggcgggaagctgagccactcggca
ccgttcgtcgcggccggcccgtcgctcgcggcgtcgctcgcggcggacgcgaagctcctg
cccggggtggcgcaggggaagccgggcgagccgtaccgcgcgaagtgcctgatgatcgcc
gagaagctgcggcgcaccctcgcgttcgtgcgcacgcacgcggacgactggggcgcggac
gcgcaggccccgcccgccggggtgtacgtcggccgcggcgagttgctcgccgacctcacc
ctgatcgccgacgacctgcgccgggcgggtgcgaccgcgagcgccgacggggccgtgcgg
gacttcattcggctcgtggaggtgttcgggctgcacctcctgacgctcgacatccgtcag
cacagcgccaggcacgaggccgcgaccgcggaggtgctggccgcggccggggtgtgcccg
aactacgcggccctgtcggcggacgagcggttcgcggtgctcgcgaaggagctggagtcc
tcgcgcccgctggtccccgcgcacctgccgttcaccccggacacgacggaggtggtccgc
acgttccgcacgatggcggcggtcctggagcagcggtgcccggaggcgctcgggacgtac
atcatcagctcgacgaccgagccggtccacctgctcgaggtgctcctcttcgcgcgcgag
gcgcggctgttccggcccgcggagggcgtgagccgcatcgacgtggtgccgctgttcgag
gccctggagccgctccgctcggcccgccggatcgtcacccggctgctcgagctgcccgtg
taccggcggcaggtcgagctgcgcgggaaccggcaggaggtgatgatcgggtactcggac
agcaacaaggagagcgggttcctgcagtccgcgtgggcgctgtaccgcgcccaggccgag
ctgaccgagctgggccgcggggcgggcgtcacgatccagttcttccacggccgcgggggc
gcggtcgggcgcggcggcgggccggcgaactacgcgatcctggcccagcccaagggcacc
gtggacggccgcatccggatcaccgaacagggcgagatgatcgccgaccggtacgggcac
ccggccgtcgccgagcggcacctggagcaggtgctggacgcggtcctgcggaccagcttc
ccggacgcggcggagggggccgacccgaagtggctcgcggccctcgacgcgctggcggac
tcggcccggaagcactaccgggggctggtgtacgaggacccggggttcctcacgtacttc
gagcaggcgacctgcatcggcgagatcgcggagctgaagatcgggtcgcgcccggcccgg
cggagcggcgcgcggagcattgaagagctgcgggcgatcccgtgggtgttcagttggatg
cagagccggcacacgctgcccgggtggttcgggctcgggagcgcggtcgcggagttcctg
cgcgcgaacccggacggcctcgcgatgctctctgacatgtacgcccgctggccgttctgg
cgcaccctgatcgacaactcgcagatgatcctcgccaaggccgacatggtcatcgcccgg
ttgtacgccgacctcgtgacggaccaggccctggcggcccgcatctacgggcggatcgag
ggggagtaccgggcggcggtggacgcggtgtgccggatcacgggccagtcggcgctgctc
gaacggtcccccgtgctggggacgtcgatcgagcggcggaacccgtacgtggacccgctg
agcttcatccagttggtgctgctcgaccggctgcggaaccagagcggcccgcgcgaggag
ctggtgacggcggtgctggagagcatcaacggggtcgcgtccgggctgaagaacacgggg
tga

DBGET integrated database retrieval system