KEGG   Gluconobacter oxydans H24: B932_0177Help
Entry
B932_0177         CDS       T02348                                 

Definition
(GenBank) alcohol dehydrogenase GroES domain-containing protein
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
goh  Gluconobacter oxydans H24
Brite
KEGG Orthology (KO) [BR:goh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B932_0177
Enzymes [BR:goh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     B932_0177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 D-ser_dehydrat Shikimate_DH ADH_N_2
Motif
Other DBs
NCBI-ProteinID: AFV99787
UniProt: K7SI75
LinkDB All DBs
Position
180022..181062
Genome map
AA seq 346 aa AA seqDB search
MSGLSAPQTTEALVIHEKGDLRLETVAVPPLKAGQALIRPAWGGICGSDMHYFLHGGAGA
SVLREPMILGHEVSGIIEAVSPDETRFRVGEAVAIHPAHPCGHCPECERGTKHLCRNMRF
FGSAAFLPHTDGGFRRDMVVETSQLHPLPSGLDVKRASLAEPFSVALHAIARAGDVTGKR
IMVQGAGPIGALIVAGLKVAGASEIVAIDLQDFALDIARKLGATTTINTGRDNHDDEYEI
VFEATGVIPALPTAIARTQKGGILVQVGIFPPGDVPAPLGQIIAREIDYRGTFRFDEEFA
EALKILADNPWIADGLITHSFPLAQYKDAFDASLDRKSSSKVLLEL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcctttccgcccctcagacaacggaagctctggttattcatgaaaagggtgat
ctgcgtttggagaccgttgcagtcccgccactcaaagcaggtcaggcgctcatacgccct
gcctggggcggtatctgcgggtcggacatgcattattttctgcatgggggcgctggcgct
tccgttctgcgtgagccgatgattctcggccacgaggtctcaggaattatagaggccgtc
agcccggatgaaacgcgtttcagggtcggagaggctgtcgccatccatccggcacatcct
tgtgggcactgcccggaatgtgaacgtggcacgaaacatctgtgccggaacatgcgcttt
tttggcagtgccgcgtttcttccccacacggatggcggtttccggcgagacatggttgtc
gaaacatcccagcttcatccgctgccatcaggtctggatgtaaaacgcgccagccttgcc
gaacccttttctgtcgctctccatgccatcgcccgcgctggcgatgttacgggtaaacgc
attatggttcagggggccggcccgattggcgccctgattgtcgcgggcctcaaagtggct
ggcgcttcagaaatcgtcgcaatcgatcttcaggactttgcacttgatattgctcgcaag
ctgggtgcgaccacgaccatcaacacaggccgtgacaatcatgacgacgagtatgaaatc
gtttttgaggccaccggcgtcataccagccctcccgactgcaatcgccaggacacagaaa
ggcggcatcctcgtgcaggtcgggattttcccaccgggcgatgtgccagctcccctggga
cagatcatcgcgcgggaaatcgactatcgggggacattccgttttgatgaagagttcgca
gaggcgctgaagatcctcgcggacaatccatggattgcggatggtctcatcacccacagc
tttccgctggctcagtacaaagatgctttcgacgcatccctggaccggaaaagctcatcc
aaggttctcctggaactctaa

DBGET integrated database retrieval system