KEGG   Gluconobacter oxydans H24: B932_0815Help
Entry
B932_0815         CDS       T02348                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
goh  Gluconobacter oxydans H24
Pathway
goh00970  Aminoacyl-tRNA biosynthesis
goh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:goh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    B932_0815
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:goh03029]
    B932_0815
Enzymes [BR:goh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     B932_0815
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     B932_0815
Mitochondrial biogenesis [BR:goh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    B932_0815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AFW00410
UniProt: K7T7D1
LinkDB All DBs
Position
complement(844046..845380)
Genome map
AA seq 444 aa AA seqDB search
MSGLQFRTLDIAAKVRGGELSAVEVTKAVFADIAQRDDSLNCVTRPLTDRALAAAAAVDA
AVAEGRDPGALAGVPFGIKDLFDVAGQVTTAGSKVLANDPPATRDAALVARLIDAGAIPV
ALTNMDEFAYGFATDNAHHGVTRNPHAPDHLAGGSSGGSAAGVAARLFSLGLGSDTNGSI
RVPASLCGIWGLRATQGRLPVEGSYPFVASLDTVGPFADSAGGLRACFEALVQAENAPVD
VGALKVARLGGWFAENMSAPMSDAVSALGTRLGATQTVELPEVARARASAFVISASEGAA
LHLHRLRTQAQNYDPAVRDRLLAGALLPASLIFQAHRLRNWFRARMHEAFADADILLAPA
VVGEAPRFDQPLIEVGGKMVSARANLGLYTQPLTLAGFPVLTVPMKTAGLPLGAQLIARP
GREDLLLALAESLERDGTAVARLV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtttgcagttccggacgctggatatcgccgcaaaggttcgcggtggggaactt
tctgcggttgaagtcaccaaggctgtattcgctgatatcgcccagcgtgatgatagcctg
aactgtgtcacacggccgttgacggaccgtgctttggctgctgcggctgcggtggatgct
gctgttgcggaagggcgggatcctggtgctctggcgggtgtaccgttcgggatcaaggac
ctgttcgatgtggcgggtcaggtgacgacggcaggatcgaaggttctggccaatgatccg
cctgctacgcgggatgctgctcttgtcgcccgcctgattgatgcgggcgccattcctgtt
gcgctgacgaacatggatgaattcgcctacggctttgcaacggacaacgcccatcacggt
gtcacgcgtaatccgcatgcgccggatcatctggcgggtggatcttcgggtgggtccgcc
gctggtgtggcggcacgtctcttttcgctgggtctggggtctgacacgaacgggtccatt
cgtgttccggcttcgctgtgcggcatctggggactccgtgcgacacaggggcggctcccc
gtcgaagggagttatccgtttgttgccagcctcgatactgtcggcccgtttgccgacagt
gcgggtggtctgcgtgcctgtttcgaagcactggttcaggccgaaaacgctcctgttgat
gtcggggcactgaaagtggcccgtctgggcggatggttcgcggagaacatgtctgcaccg
atgtcggatgctgtgagtgcactgggcactcgtctgggggcaacacaaacagtcgagctg
ccggaagtggcgcgcgcgcgggcatcggcattcgtcatcagtgcatctgaaggtgctgcc
cttcatctgcatcggttacggactcaggcgcagaattatgatccggctgttcgcgatcgt
ctgctggcaggtgcgcttttgcccgcatcactgatttttcaggctcatcgtctgcggaat
tggttccgtgcccggatgcatgaagcatttgcggacgctgatattctattggctccagcc
gttgtgggtgaggcgccgcgttttgatcagcccctgattgaagtcggtggcaagatggtg
tcagcgcgcgccaatcttgggctttatacacagccgctcacgctggccggtttcccggtt
ctgacggttcctatgaaaacggcagggcttcctctgggcgcgcaactgattgcgcggcca
ggtcgggaagatctgctgctggctctggctgaatcccttgagcgtgacggtaccgccgtc
gcccgtctggtctga

DBGET integrated database retrieval system