KEGG   Gluconobacter oxydans H24: B932_1365Help
Entry
B932_1365         CDS       T02348                                 

Definition
(GenBank) sensor protein ChvG
  KO
K14980  two-component system, OmpR family, sensor histidine kinase ChvG [EC:2.7.13.3]
Organism
goh  Gluconobacter oxydans H24
Pathway
goh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:goh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B932_1365
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:goh01001]
    B932_1365
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:goh02022]
    B932_1365
Enzymes [BR:goh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     B932_1365
Protein kinases [BR:goh01001]
 Histidine kinases
  OmpR family
   B932_1365
Two-component system [BR:goh02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   B932_1365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Stimulus_sens_1 HATPase_c HisKA Sensor_TM1 HAMP
Motif
Other DBs
NCBI-ProteinID: AFW00947
UniProt: K7SVF5
LinkDB All DBs
Position
1384546..1386360
Genome map
AA seq 604 aa AA seqDB search
MGNADPSSALAYDLDSDRLEQGRDRRHAAAARRGLLQSLQRMFTRKGPPDPRRKLASPLL
GRILLLNILPLALLAVTLLFLDQFQNSLLETDVNALREQAHIYAAAVGQSAVIAAPKVGG
KPAPGGEFVLDPSQARPLLARLTEPSPNAHALLFDPDGKLVADSQTEPKHPPKPIIPDAA
SDGLPWHPPRNNALETFYDWLLSLLPLTSSEGIVTLDTPDSATDGPHDAQPLRAQSELPP
FIRRTKDHQLVVTVVEPVVHEGLTVGEIQLTRHAPEVDRSLFAVRSSILSLVLAALVVTI
LLSWYLSLTIARPLLTLARASHEMRESDGRKDLVPERLLARRDEIGVLARSLRGSALALW
ARMDDIERFAADVSHEIKNPLSSIRSAIETLPRIAIPERRDRLLGIINSDVKRLDRLITD
ISDASRIDAELSRVRPEPVSVVALLSILAEMHQTTRKDDAPVLRLDVRDQEPPLRAFAVE
DRLVQVLRNLIGNAVSFSPPKGVIALHASARDIAGSGPGTGSVVEITISDQGPGIPPGKL
DSIFDRFYSERPQTEHFGQHSGLGLAISRQIIHALRGSLFAENILDASGAISGACFVVRL
PRAT
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
gtgggtaacgcagacccttcttccgccctcgcttatgatcttgattcggaccgtctcgag
caggggcgtgaccgtcgtcatgccgcagcagcgcggcgcggactcctgcagtccctgcaa
aggatgttcacccgaaaaggccctcccgacccacggcggaaacttgcgtctcctctcctt
ggacgcatccttctcctgaatatccttccgctggctctgctggcggtgacgcttctgttt
ctggatcagtttcagaacagtcttctggaaacagacgtcaacgccctgagagagcaggca
catatttacgcggctgctgtggggcagtctgctgtcattgccgcccctaaagtcggggga
aaaccggcgcctggcggagagttcgtgcttgatccctcgcaggcgcggccattgctggcg
cgtctgaccgagccaagcccgaacgcgcatgcgctgctgttcgatccggacggaaagctc
gtggcggatagccagacagagccaaaacaccccccgaaacccattatcccggatgccgca
tcggatggtctgccctggcatccccctcggaacaatgcgctggagacattttacgattgg
ctgctgtctctgctgccgctgacgtccagcgagggaatcgtgacgctggatacgccggat
tcagcgaccgatggcccgcatgacgcgcagcccttgcgggcgcagtcggagcttccccct
ttcatccgtcgcacaaaagaccatcagcttgtggtcacggttgttgaaccggtggtgcat
gaaggtctgactgtgggtgagatccaactgacccgacatgctccggaagtggatcggtcg
ttgtttgcggtccgttcatccattctatccctggtgctggcagcgctcgtcgtcactatt
ctgctgtcctggtacctctccctgactatcgctcgaccgttgctgacactggcgcgggct
tctcatgaaatgcgggaatctgacgggcgtaaggatctggtccccgagcgtctgctggcg
cgacgggacgagattggcgttctggcaagatctctgcgcggcagtgcgctcgcgctttgg
gcacgcatggatgatattgagcggttcgccgccgatgtcagtcatgagatcaagaacccg
ctgtcgtcgatccgttcggcgattgaaacgcttccaagaatcgcgattccggaacggcgt
gatcgtctgctgggaatcattaacagcgacgtgaaacgccttgatcgactgattacggac
atttcggatgccagccgcattgacgccgaactgtctcgtgtccgaccggagcctgtctct
gtcgtcgcacttttgtctattctggcggaaatgcaccagaccacacgcaaggatgatgct
ccggtcctgcgtcttgatgttcgggatcaggagccgccacttcgggcttttgcggtggaa
gaccggctggttcaggttctgcgcaatctcatcggtaatgctgtttcgttttcaccgcct
aagggtgtgattgcccttcatgccagcgcacgggacattgcggggagtggtccaggaaca
ggcagcgtggtggaaatcaccatcagtgaccaagggcccggaattccgcccggaaagctc
gacagcatctttgaccgtttctactcagagcggccgcagaccgagcatttcggtcagcat
tccgggttgggtctggccatcagtcgtcagatcattcacgcgctgcgtggaagcctgttt
gctgaaaacattctcgacgcttcgggtgcaatttccggcgcctgctttgtcgttcggctt
ccccgcgcaacctga

DBGET integrated database retrieval system