KEGG   Gluconobacter oxydans H24: B932_1556Help
Entry
B932_1556         CDS       T02348                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
goh  Gluconobacter oxydans H24
Brite
KEGG Orthology (KO) [BR:goh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B932_1556
Enzymes [BR:goh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     B932_1556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like Thi4 Glutaredoxin DAO AlaDh_PNT_C FAD_binding_3 NAD_binding_8 HD_4
Motif
Other DBs
NCBI-ProteinID: AFW01135
UniProt: K7T969
LinkDB All DBs
Position
1578018..1579598
Genome map
AA seq 526 aa AA seqDB search
MLQDDLKTQMRAYMEYLRSDVVLEATLGADDRSVEVRGLLEDIASLSDKVTFSDAGTASR
RPSFVICRAGSVEQVTFAGLPMGHEFTSLVLGLLQVSGHPPKIEADLVEQIKALDGDFHF
ETYFSQSCQNCPDVVQALNAMSVLNPKIRHAAIDGADFPEEVERLGIRSVPQVYLNGEPF
ASGRMEVADILAKLDASSVERAAAKLKDVAPFDVLVLGAGPAGASAAIYAARKGLRTGLV
ADRFGGQVMDTAGIENFISVKETEGPQLAGALEAHVRQYDVQIIASQKAAKLVPTKQPGG
LHEIVLESGATLRSKTIILATGARWRQLGVPGEEDYRTKGVAYCPHCDGPFYKGRPVVVT
GGGNSGVEAAIDLANIVSHVTLLQRGAHLKADKVLQDKLLSLPNVTVLMSALTTKIEGDG
KEVTGLTYSDADGGLHHIKTDGVFVQIGLLPNTDWLKGSLDLSPYGEIVINDHCATSVPG
IFAAGDATTVPYKQIVIAMGEGAKASLSAFDYLIRMPAVQKEVELA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaggacgacctgaaaacccagatgcgcgcctatatggagtacctgcggagcgac
gtcgtgctcgaagccacgcttggcgctgacgaccgctctgttgaagtgcgcggattgctg
gaagatattgccagcctgtcagacaaggtgacgttttccgacgccggaacagcatcgcgc
cgcccctccttcgtgatctgccgtgccggttccgtggaacaggtgacgtttgctggcctg
cccatggggcatgagttcacgtctctggttctgggtctgcttcaggtcagtgggcacccg
cccaagatcgaggccgatcttgttgaacagatcaaggcgctggatggggacttccatttc
gagacgtatttctcccagtcctgccagaactgcccggatgtcgtgcaggctctgaacgcc
atgagcgttctgaacccgaagatccgtcatgcggcgattgatggcgcggacttcccggaa
gaagtggaacgtctgggtattcgctccgtgccgcaggtctatctgaacggggagccattc
gcatctggccgtatggaagtcgcggatattcttgccaagctggatgcgtcttctgttgag
cgcgcagctgccaagctgaaggatgtggcaccgtttgatgtgcttgtgctgggcgctggc
cctgccggtgcatcggctgccatctatgcagcgcgtaaaggcctgcggaccggacttgtg
gctgatcgctttggcggacaggtcatggatacagctgggatcgagaacttcatttccgtg
aaggaaacggaaggtccgcagttggccggagcgctggaagcccatgtgcgccagtatgac
gtgcagattattgcctcccagaaagctgcgaaactggttcccacaaagcagccaggtgga
ttgcacgagattgttctggaaagcggagcgaccctgcggtccaagacgattattctggcg
acaggggcgcgttggcgtcagcttggtgttcctggcgaggaagactatcgcacgaagggc
gtggcttattgcccgcattgcgatggcccattctacaagggacgcccggttgtcgtgacc
gggggcggcaatagtggtgtggaagctgcgattgatctggccaacatcgtgtcccatgtc
acgcttctgcagcgtggcgcgcatctaaaggcggacaaggttttgcaggacaagctgctg
agcctgccaaacgtcacggttctgatgagcgcgctcaccacgaagatcgaaggcgatggc
aaggaagtgaccggcctgacctacagcgatgcggatggtgggctgcatcacatcaagacg
gatggtgtgttcgtgcagatcgggctgctacccaatacggactggctcaagggttctctg
gacctgagtccgtatggtgagatcgttattaacgaccattgtgcgacgtctgtcccgggc
attttcgcggctggtgatgcgacgactgtgccctacaagcagatcgtgattgcgatgggc
gagggggcgaaggcatctctttccgcctttgattacctgatccgtatgccggccgttcaa
aaggaagttgaactggcctga

DBGET integrated database retrieval system