KEGG   Gluconobacter oxydans H24: B932_2000Help
Entry
B932_2000         CDS       T02348                                 

Definition
(GenBank) Tuf
  KO
K02358  elongation factor Tu
Organism
goh  Gluconobacter oxydans H24
Brite
KEGG Orthology (KO) [BR:goh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:goh03012]
    B932_2000
   03029 Mitochondrial biogenesis [BR:goh03029]
    B932_2000
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:goh04147]
    B932_2000
Translation factors [BR:goh03012]
 Eukaryotic Type
  Elongation factors
   B932_2000
 Prokaryotic Type
   B932_2000
Mitochondrial biogenesis [BR:goh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    B932_2000
Exosome [BR:goh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   B932_2000
  Exosomal proteins of breast cancer cells
   B932_2000
  Exosomal proteins of colorectal cancer cells
   B932_2000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RGP RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AFW01567
UniProt: K7SX30
LinkDB All DBs
Position
2026159..2027349
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHCNIGTIGHVDHGKTSLTAAITKTLAKSGGAEFKAYDMIDAAPEERARG
ITISTAHVEYETKNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKVDQVDDPELLELVEMEVRELLSSYQFPGDDIPIVKGSALVTLE
DGDATIGEDRVLELMEAVDTYIPQPERPVDRPFLMPIEDVFSISGRGTVVTGRVERGVVN
VGDEVEIVGLKDTIKTTVTGVEMFRKLLDRGEAGDNIGALVRGTKREDVERGQVLAKPGS
ITPHKKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVTLPEGTEMVMPGDNVA
MDVELIAPIAMDEGLRFAIREGGRTVGAGVVSSISA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggctaaattcgagcggacgaagccgcactgcaacatcggcaccatcggtcac
gtcgaccacggcaagacctcgctgactgctgcaattaccaagacgcttgcgaagagcggc
ggcgccgagttcaaggcgtacgacatgatcgacgcagcgccggaagagcgcgctcgtggt
atcaccatttccacggcacacgttgagtatgagacgaagaaccgtcactatgctcacgtt
gactgcccgggtcacgctgactacgtcaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggttgtgtctgctgctgacggcccgatgccgcagacgcgtgagcacatc
ctgctcgcacgtcaggttggcgtgccggctctggtcgtgttcctgaacaaggttgaccag
gttgatgatccggagcttctggagctcgtggagatggaagttcgtgaacttctttcttcc
taccagttcccgggcgacgatatccccatcgtcaagggctccgctcttgtgacgcttgaa
gacggcgatgccaccattggtgaagatcgcgttcttgagctgatggaagctgtcgacacg
tacatcccgcagccggagcgtccggttgatcgtccgttcctgatgccgatcgaagacgtg
ttctcgatttccggccgtggtacggttgtgacgggtcgtgttgagcgtggcgttgtcaac
gtcggtgacgaagttgaaatcgtcggcctgaaggataccatcaagacgaccgttacgggc
gttgagatgttccgcaagctgcttgatcgcggtgaagctggtgacaacatcggtgcgctg
gttcgtggtacgaagcgtgaagatgttgagcgtggccaggttcttgcaaagccgggttcc
atcaccccgcacaagaagttcaaggctgaggcttacatcctcacgaaggaagagggtggt
cgtcatacgccattcttcacgaactatcgtccgcagttctatttccgcacgaccgacgtc
actggtgttgtgacgcttccggaaggcacggaaatggtgatgccgggtgataacgttgct
atggatgtcgagctgattgctccgatcgccatggacgaaggtctgcgtttcgcaattcgc
gaaggcggccgcaccgtgggtgcaggcgtggtttcctccattagcgcctaa

DBGET integrated database retrieval system