KEGG   Gluconobacter oxydans H24: B932_2419Help
Entry
B932_2419         CDS       T02348                                 

Definition
(GenBank) putative phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
goh  Gluconobacter oxydans H24
Pathway
goh00620  Pyruvate metabolism
goh00680  Methane metabolism
goh01100  Metabolic pathways
goh01120  Microbial metabolism in diverse environments
goh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:goh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B932_2419
  09102 Energy metabolism
   00680 Methane metabolism
    B932_2419
Enzymes [BR:goh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     B932_2419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase DUF2802
Motif
Other DBs
NCBI-ProteinID: AFW01975
UniProt: K7TBB7
LinkDB All DBs
Position
complement(2410634..2413456)
Genome map
AA seq 940 aa AA seqDB search
MEHNLPVFNLPSAEARLLPMSDCASRHDTSLSARIDTMTTHLIQERNGLGDLIASIGEDL
SVSKGEKIEELEQTVRALRDEHFIQRAAHLRQYVGLEDADPASRLQQVAAKLVEQAASPE
ALSKAAIAAVFTAHPTFALADHVYALLAERASDPELPLPCLTTHRRAAPPTLAHEQSLAL
AAILRGRDALDELSTSLIGKMTARWANEADHIDPAPVILASWVGFDTDGRNDIGWWDTIR
IRLELKLSQLERLETGLASLTLQDSALAMRVRRAMEAVKTQHAACPSGKNAAPEAIRDFA
HTLIAHREKALLDAQELLPLFRDAAAGLDASATLKLRTIRAGFMSHGLSIAHIHTRLNAA
QIYNVARTRLGLTDDPALPSRRRVLLSRINDALDDLTPRHVDFGSLLVEPASAARLMMTM
AQILKHIDSGSPIRFLIAETESGYTLLATLWLARLFGIQDHQIEISPLFETESALENGET
ILEEAFRSPHWRNYLRANGRLSLQFGYSDSGRYVGQLAATNLVERLRMRTLALLKEHDLE
DISLTLFDTHGESIGRGAHPFTLRQRLDYFSPARTRIAFRDAGVGCRVETAFQGGDGYTL
FGTNSIAASTIATLAEHVAHVPTNVNDPVYDRPDFAADFFSTIALDMGALVNDPGYAALL
SAFGPSLIDKTGSRPSARQSDAATVTRITHPSQLRAIPNNAILQQLGWWANVLHGLGNAA
QRHPETFEHFVNSSPRFREAMDFARQALAHSDLEVLRATVRQLDPGTWLDRASKAHDEEE
RQNFLTISHGLEVLQFWTSAPAMFRRIQTDHIALRAAWPEAPQMEPREKLLHAIRFALID
RLWVLSTRIPYFGPRNNLTRDSITNLVLCLDIPRSLDLLDDLFPVSALSVANLDFGEPGG
AGEESGFAREHREIFQPLERYFNLLREIGIAVMHANRAFG
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
atggaacataacttgcccgttttcaatttaccttccgcagaagcgagactgctcccgatg
tctgactgcgcctcccggcacgacacatccctttccgcacgcatcgacaccatgaccacg
cacctcattcaggagcgtaatggtctgggtgatctgattgcctctattggtgaggatctg
tcggtcagcaaaggcgagaaaatcgaggagctggaacagacagtccgggcattgcgcgat
gaacatttcatccagcgcgctgctcatctgcggcagtatgtcggcctcgaagacgccgat
cctgcttcccggctgcaacaggtcgctgccaagcttgtagagcaggccgcctcaccggaa
gcgctttccaaggccgcaatcgccgcagttttcacggctcatccgaccttcgctctggcc
gaccatgtttatgcccttctggcggaacgggcttcagatcctgaactgccgttaccgtgc
ctgacaacgcaccgccgcgctgcgccgccaacactggcccatgaacaatccctggcactt
gctgcgatcctgcgtggccgggatgcacttgatgagctgagcacgtcacttatcgggaag
atgaccgcacgatgggcgaacgaggccgatcatatcgatccggctccggtcattctggca
agttgggtcggctttgatacagacggacgaaacgatatcggctggtgggacacgatccgg
atccggctggaactcaaactctcacagcttgagcgtcttgagactggtcttgccagcctg
acccttcaggactcagccctcgccatgcgcgtccgtcgcgcgatggaagctgtcaaaaca
caacatgctgcctgcccgtccggaaaaaatgctgcacctgaagctatccgtgactttgcc
cacacactgatcgcgcatcgcgaaaaagctcttctggacgctcaggagcttttaccgctg
ttccgggatgccgcagcaggcctcgatgcttcggcgacactcaagctacgcacgatccgc
gcaggcttcatgagccatggcctgagcattgcgcatattcatacacgtctcaacgcagca
cagatctacaatgttgcccggacgcgtcttggcctcacagatgaccccgctcttccgtca
cgacgccgcgttcttctgtcccgcattaatgatgcactggatgacttgacgccgcgccat
gtggattttggttcgctccttgtggagccggcatctgccgcccgtctgatgatgacgatg
gcgcagattctcaagcatattgattccggttctcctatccgcttcctgattgccgaaacg
gagagcggttacactcttctcgcaacactctggcttgcacgcctgttcggcattcaggac
catcagatcgagatttccccacttttcgagacagaaagtgcgttggaaaatggcgagacg
atccttgaggaagcgttccgttctccgcactggcgaaactatctgcgcgccaacgggcgc
ctctccctgcaatttggctattcggattccggccgttatgtcgggcagcttgcggcaacg
aaccttgtcgagcgcctgcgaatgcggacactggctcttctgaaagagcatgatctcgaa
gacatttccctgacgcttttcgacactcatggcgaaagcattggccgcggcgcccatccg
ttcactctccgccagcgcctcgattatttttcccctgcccgtacgcggattgccttccgc
gatgctggtgtcggctgtcgagtggaaacggctttccagggcggagacggctatacgctt
ttcggaacgaacagtattgcagcgtccaccatcgctacattagccgagcatgttgcccat
gttccaaccaatgtgaacgatccggtctatgaccgtccggactttgctgccgactttttc
tccacaattgctctcgatatgggcgcgctcgtcaatgatcccggttatgcagcgctcttg
agcgcgtttgggccgtcccttatcgacaagacaggatcccgcccttcagcgcgccaatcg
gacgcagctactgtgacgcggatcacgcatccaagccagctccgggccattccgaataac
gcaatccttcagcagctcggctggtgggcaaatgttctgcacggcctgggcaatgctgcg
caacgccatccggaaacattcgagcatttcgtgaacagttcgccccgtttccgcgaggct
atggattttgcgcggcaggctctggcccattcggacctggaagttcttcgcgcgaccgtg
cggcagcttgatcctggcacttggctggatcgcgcttcaaaggctcatgatgaggaagaa
cgtcaaaatttcctcaccatctcacatggtctcgaagtcctccaattctggacaagcgcc
ccagcgatgttccgccgaatccagacggatcacattgccctgcgagctgcctggccagaa
gcaccgcagatggagccgcgcgaaaagctgcttcatgccatccgcttcgccctgatcgac
agactgtgggtgttgtccactcgcatcccttattttggaccacgcaacaacctgacgcgg
gactccattaccaatctggtcctctgtctcgatattccccgctcgctggatctgctcgat
gatctgttccctgtttccgcactcagcgtggccaatctggattttggtgaaccgggaggc
gccggagaagaaagcggcttcgcacgtgagcatcgtgagatcttccagcctctggaacgc
tacttcaacctgctaagggaaattggcattgcggtcatgcatgccaaccgtgctttcggc
taa

DBGET integrated database retrieval system