KEGG   Gluconobacter oxydans H24: B932_3019Help
Entry
B932_3019         CDS       T02348                                 

Definition
(GenBank) NAD-dependent xylitol dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
goh  Gluconobacter oxydans H24
Pathway
goh00040  Pentose and glucuronate interconversions
goh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:goh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B932_3019
Enzymes [BR:goh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     B932_3019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: AFW02564
UniProt: K7SGR0
LinkDB All DBs
Position
3067023..3068066
Genome map
AA seq 347 aa AA seqDB search
MAQALVLERKGELSLREIDVPDVLGPDDVRVAIHTVGICGSDVHYYTHGRIGHFIVDAPM
VLGHEASGTVTEVGSRVTSLQVGDRVCMEPGIPDPTSRASKMGIYNVDPAVTFWATPPIH
GCLTPSVVHPAAFTYRLPENVSFAEGAMVEPFAIGVQAAVKAALKPGDTCLVTGCGPIGL
MTALAALASGAGTVFISDIAAPKLQIAGQYKGLVPLNAKEVRPRDAVSQQCGADWGVDVV
FEASGFPGAYDDVFSCVRPGGTVVFVGMPVEKVPFDLVAAQAKEIRMETVFRYANVYERA
IALISSGKVDLKPLISETFPFAEGIAAFERAASARPTDVKLQIKLPG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagctttggttctggaacgtaaaggcgaactgtccctccgagagattgacgtg
cctgatgtcctcggccctgatgacgtcagggtagcgatccatacagtcggtatctgcgga
agtgatgtccattattatacgcatggacgcatcggtcatttcatcgtagacgctccgatg
gttcttggccatgaggcctcaggcaccgtgacggaagttggttcacgcgtaacaagtctt
caggttggcgatcgtgtctgcatggagcctggcattcctgaccccacctcacgcgcgtct
aaaatgggtatttacaacgttgatcctgccgtaactttctgggcgacgccgccaattcat
ggttgcctcaccccctcggtcgtacacccagcggcctttacttacaggcttcctgagaat
gtttcattcgccgaaggcgccatggtagagccattcgctattggcgttcaggcagccgtc
aaagccgccctgaagccgggcgatacatgtctagtcacggggtgtggaccgattgggctt
atgacagcactggcagcactggcttcaggggcaggaacagtttttatttccgatatcgcc
gctccgaagttgcagatcgctggacaatataaaggtctcgttcccttgaacgctaaagaa
gtacggccacgcgatgcggtgtcgcagcagtgcggagcggactggggtgttgatgttgtt
ttcgaggccagcggctttccgggggcatatgacgatgtcttttcctgcgtccgccccggt
ggaaccgttgtgttcgtcggaatgcctgtcgagaaggtcccgtttgatctggtcgcagct
caagccaaagaaatccgaatggaaacagtcttcaggtacgcgaatgtctatgaacgtgcc
attgccctgatttcttcaggaaaagtggatctcaagccccttatttctgaaacgtttcca
tttgcagaaggtatcgcagcctttgaacgcgcggcttccgctcgtccaacggatgtgaag
ctacaaattaagcttccaggctga

DBGET integrated database retrieval system