KEGG   Gluconobacter oxydans H24: B932_3521Help
Entry
B932_3521         CDS       T02348                                 

Definition
(GenBank) chorismate mutase
  KO
K04092  chorismate mutase [EC:5.4.99.5]
Organism
goh  Gluconobacter oxydans H24
Pathway
goh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
goh01100  Metabolic pathways
goh01110  Biosynthesis of secondary metabolites
goh01130  Biosynthesis of antibiotics
goh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:goh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B932_3521
Enzymes [BR:goh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     B932_3521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CM_2
Motif
Other DBs
NCBI-ProteinID: AFW03060
UniProt: K7TE90
LinkDB All DBs
Position
3580409..3580723
Genome map
AA seq 104 aa AA seqDB search
MTSDSSSALAELERLRASIDNIDAALIHMLAERFRCTKAVGELKARSSLPAADPNREARQ
IERLRQLARDAHLDPDFAEKFLAFVIREVIRHHEAIAAQTNGSH
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgacagctcttccgccctcgcagaacttgagcgcctgcgtgccagcatcgac
aatatcgacgccgccctgattcatatgctggcagagcggttccgctgcaccaaggcagtt
ggcgaactgaaggcgcgttccagccttcccgccgcagaccctaaccgtgaagcccggcag
atcgaacgcctgcgccagcttgcacgagacgctcatcttgatccggattttgctgaaaaa
ttcctggctttcgtcatccgtgaggtcatccgtcatcacgaggccattgccgctcaaacc
aacggttcgcactga

DBGET integrated database retrieval system