KEGG   Gordonia sp. MMS17-SY073: D7316_03013Help
Entry
D7316_03013       CDS       T05722                                 

Gene name
ligD_1
Definition
(GenBank) Multifunctional non-homologous end joining DNA repair protein LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
gom  Gordonia sp. MMS17-SY073
Pathway
gom03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:gom00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    D7316_03013 (ligD_1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gom03400]
    D7316_03013 (ligD_1)
Enzymes [BR:gom01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     D7316_03013 (ligD_1)
DNA repair and recombination proteins [BR:gom03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     D7316_03013 (ligD_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AZG46412
UniProt: A0A3G8JPG6
LinkDB All DBs
Position
3265795..3268200
Genome map
AA seq 801 aa AA seqDB search
MVVMAGGDGLEVDGRRIPITNLEKVLYPETGTRKFEVVDYYSRIADVMLPHLAGRPITRK
RWPNGVESMPFFEKDLPASAPDWLERFGEQHSKRVITYPLASSQADLVWFGQMAALELHT
PQWRVPATEGSAPKADRLVLDLDPGPDVPLSQCAEVALMIRDMLSAAGLTAFPVTSGGKG
LHLYARFDRPVSPDAARTVAKQIATSLAASHPAEITATMSKSIRTGKVFIDWSQNSGSKT
TLAPYSMRGRDQPWVAAPRTWDELTDPDIGQLLFHEVLERVAAEGDLLRDLDDAHGPDDT
AGADDTEELDPDAVAAAAATAAPVANPVVSLGEYRRKRDADKTPEPFGDEAHRERGDDTD
IGAGPIFVIQEHHARRLHYDFRLERDGVLVSWAVPKNLPDDPGQNRLAVHTEDHPMDYAD
FEGDIPAGEYGGGHVEIWDRGTYETEKWRENEVIVRLHGERVQGRYALIKTGDKNWLAHL
MSDEPRPILPDSLKDPRPMLATDESIENLDGRDWAFEGKWDGYRILVRYIDGDFRLTSRS
GIDMTADFPQLRSIADDLGLIDVVLDGEVVALDASGRTNFTLLAARNTTDDDLTLKLYIF
DILFLNGTSLLRRPWSQRRELLEELAPAFARSTHAEVPPLLDGPGRAAVAHSREQGYEGV
VAKRRTSTYQQGRRTTQWLKQKNWSDIEVVIGGYRPGRGNRSDTIGSLLLGLPEETGLRY
VGRVGTGFTDAQLRSLAAELEPLRIKTCPFVDKLDRPVASSAVWVLPKIVGEVRFMDWTT
TGHLRHPSWRGIRRDKLPGDL
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtcatggcgggtggtgacggtctcgaggtcgacggtcgtcgcataccgatcacc
aacctcgagaaggtgctctacccggagacgggaacccggaagttcgaggtcgtcgactac
tactcgcgtatcgccgacgtcatgctcccgcatctcgccggacgcccgatcacccgcaag
cgctggcccaacggcgtcgagtcgatgccgttcttcgagaaggacctccccgcgtcggca
ccggattggctcgaacggttcggtgaacaacacagcaaacgggtgatcacctatccgctc
gcgtcgtcgcaggccgacctggtgtggttcggccagatggcggcgctcgaactgcacacg
ccgcagtggcgtgtcccggcaaccgaggggtccgcaccgaaggccgaccgcctcgtcctc
gacctcgaccccggccccgacgtcccgctctcgcagtgtgccgaggtcgctctgatgatc
cgcgacatgctgtccgcggccggactcaccgcctttccggtgaccagcggcggcaaggga
ctgcacctgtatgcgcggttcgaccgtcccgtctcaccggacgccgcgcggaccgtcgcc
aaacagatcgccaccagcctggccgcgtcgcatcccgccgagatcaccgcgacgatgtcc
aagtcgatccggaccggaaaggtcttcatcgactggagccagaacagcggctccaagacg
acgctggcgccgtattcgatgcgcggtcgcgatcagccctgggtggccgcgccccgcacc
tgggacgaactcaccgatcccgacatcgggcagctgctcttccacgaggtcctcgaacgc
gttgccgcggagggcgatctgctgcgtgatctcgacgacgcgcacggacccgacgacacc
gccggcgcggacgacaccgaggaactcgaccccgacgcggtcgccgcggcggctgccacc
gctgcccccgtcgcgaatcctgttgtcagccttggtgagtaccgacgcaagcgggatgcg
gacaagacgcccgagccgttcggcgacgaggcccaccgcgagcgcggcgacgacaccgac
atcggtgccggaccgatcttcgtcatccaggagcaccacgcgcgccgactgcattacgac
ttccggctggaacgcgacggcgtgctggtgtcctgggcggtcccgaagaacctgcccgac
gaccccggtcagaaccggctcgcggtgcacaccgaggaccaccccatggattacgccgac
ttcgagggcgacatccccgccggcgagtacggcggcgggcatgtggagatctgggaccgc
ggcacgtacgagaccgagaagtggcgcgagaacgaggtgatcgtgcgtctgcacggcgag
cgcgtgcaggggcgctacgcgctcatcaaaaccggcgacaagaactggctcgcccacctg
atgagcgacgagccgcggcccatcctgccggacagtctcaaggatccgcggcccatgctg
gcgaccgacgaatccatcgagaacctcgacgggcgggactgggccttcgagggcaaatgg
gacggctaccgcatcctggtgcgctacatcgacggcgacttccggctgacgtcgcgctcc
gggatcgacatgaccgccgacttcccgcaactgcgttccatcgcggacgatctcgggctc
atcgacgtggtcctcgacggcgaggtggtggcactcgacgcgagcgggcgcaccaacttc
accctgcttgccgcgcgcaacaccaccgatgacgacctgacactgaagctctacatcttc
gacatcctgttcctgaacgggacgtcgctgctgcgccggccgtggtcacaacgtcgcgaa
ctcctcgaggaactcgccccggcgttcgcgcggtcgacccacgccgaggtgccaccgctg
ctggacgggccgggccgggcggccgtggcgcacagcagggaacagggctatgagggtgtg
gtcgccaagcgtcggacgtcgacgtaccagcagggcaggcgcaccacgcagtggttgaaa
cagaagaactggagcgacatcgaggtggtcatcggcggctaccgccccggccgcggcaac
cgctcggacaccatcggatcattgctgctcggactgccggaggagaccggcctgcggtat
gtcgggcgcgtcggcaccggcttcaccgacgcccaactccgttccctcgccgccgaactc
gagccactgcgcatcaagacctgcccgttcgtcgacaagctggaccgcccggtggcgtcg
agtgcggtctgggtactgcccaagatcgtcggcgaggtccggttcatggactggaccacc
accggccacctgcgccatcccagttggcgtggcatccggcgggacaaactgcccggagac
ctctga

DBGET integrated database retrieval system