KEGG   Gordonia sp. MMS17-SY073: D7316_03658Help
Entry
D7316_03658       CDS       T05722                                 

Gene name
pknB
Definition
(GenBank) Serine/threonine-protein kinase PknB
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
gom  Gordonia sp. MMS17-SY073
Brite
KEGG Orthology (KO) [BR:gom00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gom01001]
    D7316_03658 (pknB)
Enzymes [BR:gom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     D7316_03658 (pknB)
Protein kinases [BR:gom01001]
 Serine/threonine kinases: Other
  Bacterial family
   D7316_03658 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Kdo Seadorna_VP7 RIO1 Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: AZG47051
UniProt: A0A3G8JPN4
LinkDB All DBs
Position
complement(3960856..3962775)
Genome map
AA seq 639 aa AA seqDB search
MSTPHHLSDRYELGETLGFGGMSEVHFARDLRLHRDVAVKVLRADLARDPTFYLRFRREA
QNAAKLNHPTIVQVFDTGEAETPDGPLPFIVMEYVDGETLRDVLRSNGPVSPRQAMTWMA
DVAAAMDFSHRNGIVHRDMKPANVMIDKAGAVKVMDFGIARAMSDSTSTMTQTSAVMGTA
QYLSPEQARGIKVDPRSDIYSMGCVLFELMTGEPPFTGDSPVAVAHQHVHEDPPWPSSIR
PEIPRELDSVVLKAMSKNPANRYQSAADLRSDLIKVLAGGKPSAPMLLSDEDRTEFMDSG
PRRALTDSGPRRPVTSHRRDPDGDDDASTPRRRMRGLVIGAVAAVVVLVAGLLLWSPWGS
DVARQVPVPTVVGQPSTQARDSLEKAGFRVKQLDEPSLDVAAGSATRSTPAENVLASEGS
EITLYISTGPQRHKMPDLRGKMPDEATEALRVLGFSNVKTDRVDSTGELKDKVVNTTPPT
GAEAPVNGAVVVHVGNGPKEITVPDVTGQTEDAARTVLEQVGLRVVTVAGDSELPAGRVV
SSSPDGGVTVEQGSTIQIVVSRGNMFVMPNLRGQTPAQARGTLAGAGWEDTTLTRSSRNV
PITSPDDGKVIGQSPAPGSRVRKDGSVSIVVGQGSLLPG
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgccccaccatctgtccgatcgctatgagctcggcgagacactcggcttcggc
ggaatgtcggaggtgcatttcgcgcgcgatctccgactgcatcgtgacgtcgcggtcaag
gtgttgcgcgccgatctggcccgcgaccccacgttctatctgcgattccggcgcgaggcg
cagaacgccgccaagctgaaccatccgacgatcgtgcaggtcttcgacaccggcgaggcc
gagacgcccgacggtccgctgccgttcatcgtgatggagtacgtcgacggcgagacgttg
cgcgatgtcctgcggtcgaacggcccggtgtcaccgcggcaggcgatgacgtggatggcc
gacgtcgccgccgcgatggacttctcccatcgcaacggaatcgtgcaccgcgacatgaaa
ccggccaacgtgatgatcgacaaggccggcgcggtcaaggtgatggacttcggcatcgcc
cgggcgatgagcgattcgacgtcgacgatgacgcagacgtccgcggtgatgggtaccgcg
cagtacctctcgcccgagcaggcacgcggcatcaaggtcgatccgcgcagcgacatctac
tcgatgggctgcgtgctgttcgaactgatgaccggcgagccaccgttcaccggcgactcc
ccggtcgccgtcgcacaccagcacgtgcacgaggatccgccgtggccgtcgtcgatccgg
ccggagatcccgcgcgagctggattcggtggtcctcaaggcgatgagcaagaacccggcc
aaccgctatcagtcggccgccgatctgcgatccgacctgatcaaggtgctcgccgggggc
aagccgtcggcgcccatgctgctgtccgacgaggaccgcaccgagttcatggacagcggc
ccgcgtcgggcactgaccgattccggcccccgacgtcccgtcacgtcgcatcgtcgcgat
cccgacggcgacgatgacgcatcgaccccccgccgacgcatgcgcggactggtgatcggt
gctgtcgcggcggtggtggtgctggtggccggactgctgttgtggtcgccgtggggttcc
gacgtcgcgcggcaggtgccggtgcccactgtggtgggtcagccgtcgacgcaggcgcgc
gacagtctcgagaaggccggattccgggtgaaacagctcgacgaacccagcctcgacgtc
gctgcgggatcggcgacccggtcgacgcccgccgagaacgtgctggcgtcggaggggtcg
gagatcacgctgtacatctcgaccggtccacaacgccacaagatgcccgacctgcgcgga
aagatgccggacgaggcgaccgaggcgctgcgggtcctcggtttctcgaatgtgaagacc
gatcgggtggactcgaccggtgagctgaaggacaaggtggtcaacaccacgccgccgacc
ggagccgaggcgccggtgaacggcgccgtcgtcgtgcatgtgggcaacggacccaaggag
atcaccgtgcccgacgtcaccgggcagaccgaggatgccgcccgcacggtgctcgagcag
gtcggcctccgcgtggtcaccgtcgccggtgactccgagttgccggccggtcgcgtggtg
agcagttcccccgacggcggcgtcacggtggagcagggcagcacgatccagatcgtggtg
tcccgcggcaacatgttcgtgatgcccaacctgcgcggtcagacgccggcgcaggcccgg
ggcactctcgccggggccggctgggaggacaccacactcacccgatcgagccgcaacgtg
ccgatcaccagccccgatgacggcaaggtcatcggccagagcccggcccccgggtcgcgg
gtacgcaaggacggctcggtgtcgatcgtggtcggccagggcagtctgttacccggctga

DBGET integrated database retrieval system