KEGG   Gordonia sp. MMS17-SY073: D7316_04413Help
Entry
D7316_04413       CDS       T05722                                 

Gene name
davT
Definition
(GenBank) 5-aminovalerate aminotransferase DavT
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
gom  Gordonia sp. MMS17-SY073
Pathway
gom00250  Alanine, aspartate and glutamate metabolism
gom00410  beta-Alanine metabolism
gom00640  Propanoate metabolism
gom00650  Butanoate metabolism
gom01100  Metabolic pathways
gom01120  Microbial metabolism in diverse environments
Module
gom_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:gom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    D7316_04413 (davT)
   00650 Butanoate metabolism
    D7316_04413 (davT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    D7316_04413 (davT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    D7316_04413 (davT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gom01007]
    D7316_04413 (davT)
Enzymes [BR:gom01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     D7316_04413 (davT)
Amino acid related enzymes [BR:gom01007]
 Aminotransferase (transaminase)
  Class III
   D7316_04413 (davT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AZG47801
UniProt: A0A3G8JRQ4
LinkDB All DBs
Position
complement(4763958..4765259)
Genome map
AA seq 433 aa AA seqDB search
MTVTTDSIRTAQTATLSPALKQATPVVVDHASGSWIHGTDGNDYLDFTTGIGVTSTGHCH
PRVVAAAQEQCTKIIHAQYTTVMHQPLLELTEKLGHVLPLGLDSVFYANSGSEAVEAAIR
LARMATARPNIIVFQGGFHGRTVAAASLTTAGTRFSAGFSPLMSGVHMSPFPYAYRYGWT
TDAAVDFALRELDYLLQSRVAPNDTAAFLIEPVLGDGGYLPTPPRFLQGLRERADRHGII
FILDEVQAGFGRTGKFWGHQHASDLTPDILITAKGLASGFPISAIAASTELMSKAWPGSQ
GGTYGGNAVAAAAAVATIDVIHDENLVDNARIRGEQMLSGLQDIAARFDAIGDVRGLGLM
AGIEFVTSSDGSTPVPDAAAAAAVQQATTRHGLLTLTCGPAGNVVRLIPALVVTESEIAT
GLERFAAALTDVL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcaccaccgactccattcgcaccgcccagaccgcgaccctgagccccgcgctc
aaacaggccacacctgtcgtcgtcgaccatgcgtccggctcgtggatccatggcaccgac
ggcaacgattacctcgacttcaccaccggcatcggcgtcacgagcaccggccactgccac
ccgcgcgtcgtcgcggccgcgcaggaacagtgcaccaagatcatccacgcgcagtacacg
acggtgatgcatcagccgctgctcgagctgaccgagaaactcggccatgtcctgccactc
ggtctcgactcggtgttctacgccaactcgggctccgaggccgtcgaggccgcgatccgc
ctcgcccgcatggcgaccgcccgcccgaacatcatcgtgttccagggcggattccacggc
cgcacggtcgccgcggccagcctcaccactgcgggaacccgtttctccgccggcttctcc
ccactcatgtcgggcgtccacatgtctccgttcccgtacgcctaccgctacggctggacc
accgacgctgccgtcgacttcgcgctgcgtgagctcgactatctcctgcagtcgcgggtc
gcgccgaacgacaccgccgcgttcctgatcgaaccggtgctgggcgacggcggctacctg
cccaccccgccccgcttcctgcagggcctgcgcgagcgcgcggaccgccacggcatcatc
ttcatcctcgacgaggtgcaggccggattcggccgcaccggcaagttctgggggcatcag
cacgcctcggacctcacgcccgacatcctgatcaccgccaaaggcctcgcctccggcttc
ccgatctcggcgatcgccgcttccaccgagctgatgagcaaggcctggcccggctcgcag
ggtggaacctacggcggcaacgccgtcgccgcggccgccgcggtggccaccatcgacgtc
atccacgacgagaacctggtggacaacgcccgcatccgcggcgagcagatgctctccggc
ctgcaggacatcgccgcccgattcgatgcgatcggcgacgtccgcgggttgggcctgatg
gccggcatcgagttcgtgaccagcagcgacggcagcacacctgtgcccgacgccgccgca
gccgcggccgtccagcaggcgaccacccggcacggcctgttgaccctcacctgcggtccc
gccggcaacgtcgtgcgtctcatcccggcactggtggtgaccgagagtgagatcgccacg
ggtctcgagcgattcgcggcagcactgaccgatgtgctctga

DBGET integrated database retrieval system