KEGG   Gordonia phthalatica: ACH46_01705Help
Entry
ACH46_01705       CDS       T04097                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
goq  Gordonia phthalatica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ALG83456
UniProt: A0A0N9ND69
LinkDB All DBs
Position
378070..379134
Genome map
AA seq 354 aa AA seqDB search
MDLPVNPPVQPMLAKAVTAVPDQPDDGPVWSYEPKWDGFRALIFRDGDEVVMASRGGKDL
ARYFPELVDAARSSLPERVVLDGEVAVAQPVSGVNRLDWDSLSQRIHPAASRVAKLAEET
PAVFIGFDALATDSLDLTGETFDVRRRALVDAAAGLDDPRIQVSRVTRDPEQARAWFTEF
EGAGLDGVVGKRLDGVYVPGKREMVKIKHKRTADCVVLGYRIHKSGTGLGSMLLGLYDGG
ELRMVGGSSAFSDKKRIELQELFEPMRLDPDHVAQGEVSRWRTAGSAEWIPIRPELVAEF
AYDQMENQRFRHTVKFLRWRPDRDAASCGYDQLEVPLTYDIYDVLETGRADDAS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtggacctccccgtgaacccgcccgtgcagccgatgctcgccaaagcggtcaccgccgtg
cccgaccagcccgacgacgggcccgtgtggtcgtacgagccgaaatgggacggcttccgc
gccttgatcttccgcgacggcgacgaggtcgtgatggcctcgcgcggcggcaaggatctg
gcgcgctacttcccggaactggtcgacgcggcgcggtcgtcactcccggagcgggtggtg
ctcgacggcgaagtggcggtcgcgcagccggtctcgggggtgaaccggctggactgggat
tcgctgtcgcagcgcatccacccggcggcgtcgcgcgtggccaaactggcggaggagacg
cccgcggtgttcatcgggttcgacgccctcgccaccgactcgctcgatctgacgggagag
acgttcgacgtgcgtcgccgagcgctcgtcgacgcggccgcaggcctcgacgacccgcgg
atccaggtcagccgggtcacgcgggatccggagcaggctcgggcgtggttcaccgagttc
gagggcgccggactcgacggcgtcgtcggcaagcggctcgacggcgtctacgtgccgggt
aagcgcgagatggtgaagatcaagcacaagcgaaccgccgactgcgtcgtcctcggctat
cggatccacaagtcggggaccgggctcggatccatgctgctgggcctctacgacggcggc
gagctgcgcatggtcggcggctccagcgccttctccgataagaagcggatcgagctgcag
gagctgttcgagccgatgcgcctcgatcccgaccacgtcgcgcagggcgaggtgagccgg
tggcggacggcgggcagcgccgagtggatcccgatccgcccggagctggtcgccgagttc
gcctacgaccagatggagaaccagcggttccggcacacggtgaagttcctgcgctggcga
cccgaccgcgatgctgcgagctgcggatacgaccagctcgaggtgccgctcacctacgac
atctacgacgtcctcgagaccggaagggccgacgatgcctcctaa

DBGET integrated database retrieval system