KEGG   Gordonia phthalatica: ACH46_02280Help
Entry
ACH46_02280       CDS       T04097                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
goq  Gordonia phthalatica
Pathway
goq00250  Alanine, aspartate and glutamate metabolism
goq00410  beta-Alanine metabolism
goq00430  Taurine and hypotaurine metabolism
goq00650  Butanoate metabolism
goq01100  Metabolic pathways
goq01110  Biosynthesis of secondary metabolites
goq01120  Microbial metabolism in diverse environments
goq02024  Quorum sensing
Module
goq_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:goq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ACH46_02280
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ACH46_02280
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ACH46_02280
   00430 Taurine and hypotaurine metabolism
    ACH46_02280
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ACH46_02280
Enzymes [BR:goq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ACH46_02280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ALG83547
UniProt: A0A0N9NDD7
LinkDB All DBs
Position
495718..497100
Genome map
AA seq 460 aa AA seqDB search
MTESDMADSLILNPVFNRDGEATELPRFEMPQEMMLPGTAYQLVHDQAMLDGNARLNLAT
FVSTYMDDEALKLYMQTVDKNMIDKDEYPATAAIEDRCWRILGNLWHNPDVDHAIGTSTI
GSSEACMLGGLALKRRWQAARKAAGKSTENPNLVMSTAVQVCWEKFANYFEVEPRWVPVT
EDHLFLDGHELEKYVDENTIGVVAIMGQTYTGAYEPVKEISAKLDRIQADTGLDVRIHVD
GASGAMVAPFCQPDLEWDFRVDRVASVSTSGHKYGLVYPGVGWIVWRDADALPESMIFHA
SYLGGDMPTLSLNFSRPGAQVLLQYYQFLRLGRDGYRAVQQGSLDVAQYLAEAIEQMGPF
ELISRGDTIPVFAWRLKAGANPNWNLYDLQDRLRMKGWQVPAYPLADDLADLTVQRIVVR
AGLSHDLASRLLMDLRAEVDFLERLDAPMPREGSESHFHH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatccgacatggccgactcgttgatcctcaacccggtcttcaaccgggacggt
gaggcgacggagctcccgcggttcgagatgccgcaggagatgatgctgcccggcaccgcg
taccagctggtgcacgaccaggcgatgctcgacggcaacgcgcggctcaatctcgcgacc
ttcgtctcgacgtacatggacgacgaggcgctgaagctgtacatgcagaccgtcgacaag
aacatgatcgacaaggacgagtacccggcgacggcggcgatcgaggaccgctgctggcgg
atcctcgggaacctctggcacaacccggacgtcgaccacgccatcgggacgtcgaccatc
ggctcgtccgaggcgtgcatgctcggcggcctcgcgctgaaacggcggtggcaggccgcg
cggaaggcggcggggaagtcgaccgagaacccgaacctcgtgatgtcgacggcggtccag
gtgtgctgggagaagttcgcgaactacttcgaggtggagccccgctgggtgcccgtcacc
gaggaccacctgttcctcgacggccacgaactggagaagtacgtcgacgagaacaccatc
ggcgtggtcgcgatcatgggccagacgtacaccggagcgtacgagccggtgaaggagatc
tccgcgaagctcgaccggatccaggccgacaccggcctcgacgtccgcatccacgtcgac
ggcgcgtccggtgcgatggtcgccccgttctgtcagccggatttggagtgggacttccgc
gtggaccgcgtggcctcggtcagcacctcggggcacaagtacggcctcgtgtatcccggc
gtcggctggatcgtgtggcgcgacgccgacgcgctgcccgagagcatgatcttccacgcc
agctacctgggcggcgacatgccgaccctgtcgctgaacttctcccgaccgggcgctcag
gtgctgctgcagtactaccagttccttcggctggggcgcgacggctaccgggccgtccag
cagggctcactcgacgtggcgcagtacctcgccgaggcgatcgagcagatggggccgttc
gagctgatcagccgcggcgacaccatcccggtcttcgcatggcggctgaaggcgggcgcg
aacccgaactggaatctgtacgaccttcaggaccgactgcggatgaagggctggcaggtg
ccggcttatccgctggccgacgacctcgccgatctgaccgtgcagcgcatcgtggtgcgc
gcaggcctcagccacgacctcgcgtcacgcctgctgatggacctgcgtgccgaagtcgac
ttcctcgaacggctcgacgccccgatgccgcgggagggatcggagtcgcacttccaccac
tga

DBGET integrated database retrieval system