KEGG   Gordonia phthalatica: ACH46_05805Help
Entry
ACH46_05805       CDS       T04097                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
goq  Gordonia phthalatica
Pathway
goq00220  Arginine biosynthesis
goq00250  Alanine, aspartate and glutamate metabolism
goq00290  Valine, leucine and isoleucine biosynthesis
goq01100  Metabolic pathways
goq01110  Biosynthesis of secondary metabolites
goq01130  Biosynthesis of antibiotics
goq01210  2-Oxocarboxylic acid metabolism
goq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:goq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ACH46_05805
   00290 Valine, leucine and isoleucine biosynthesis
    ACH46_05805
   00220 Arginine biosynthesis
    ACH46_05805
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:goq01007]
    ACH46_05805
Enzymes [BR:goq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     ACH46_05805
    2.6.1.66  valine---pyruvate transaminase
     ACH46_05805
Amino acid related enzymes [BR:goq01007]
 Aminotransferase (transaminase)
  Class I
   ACH46_05805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Alliinase_C Aminotran_5 Beta_elim_lyase DUF1412
Motif
Other DBs
NCBI-ProteinID: ALG84109
UniProt: A0A0N9N7T2
LinkDB All DBs
Position
1241535..1242746
Genome map
AA seq 403 aa AA seqDB search
MQLTQSSKLSGVSYEIRGPVAEHAARLEAEGHHVVKLNTGNPLEFGLEAPQEILSDMVRT
LPQSTGYSNSKGLLHSRRAVAQYYQTRGVANVDVDNVFLGNGVSELIMMAMTALLENGDE
VLVPAPDFPLWTAATALNGGRAVHYRCDEQADWFPDLDDMAAKITDRTRAIVLINPNNPT
GAVYSNELLEAVLELARRHSLVVFSDEIYDKILYGDAQHTSTAALADDVLCVTFSGLSKV
YRGAGLRSGWMVLTGPTADAQNYIEGLTMLAGLRLCANVPGQQAVAVAIGGRQSIYELTA
PGGRLFEQSQRAADALNAIPGISCVRPRGALYVFPKIDRNVYDIHDDEKFVLDLLLQEKL
HIVQGTGFNWPEPDHFRIVTLPHADELEAIIGRIGKFLATYRQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcacgcagtcgagcaaactctccggtgtctcatacgagatccgcggacccgtc
gccgagcacgccgcacgcctggaggcagagggccatcacgtcgtcaagctgaacaccggc
aacccactggagttcggcctcgaggcgccgcaggagatcctctcggacatggtgcggacc
ctgccgcagtccaccggctactcgaactccaagggcctgttgcattcgcggcgcgcggtg
gcgcagtactaccagacacgcggcgttgcgaacgtcgacgtcgacaacgtcttcctcggc
aacggtgtctccgagctgatcatgatggcgatgaccgcgctcctggagaacggcgacgag
gtgctggtcccggcgcccgacttcccgctgtggacggcggcgaccgcgctcaacggcggt
cgtgccgtgcactatcggtgcgacgagcaggccgactggttccccgacctcgacgacatg
gccgcgaagatcaccgaccgcacgcgggcgatcgtgctgatcaacccgaacaatccgacg
ggagccgtgtactcgaacgagctgctcgaagccgttctggagttggcgcgccgacactcc
ctcgtggtcttctccgatgagatctacgacaagatcctctacggcgacgcccagcacacc
tccaccgccgcgctggccgacgacgtcctgtgcgtcacgttctccggcctgtcgaaggtc
taccgcggtgcggggctgcgttcgggctggatggtcctgaccggtccgaccgccgacgcc
cagaactacatcgagggtctgacgatgctggcgggcctgcggctctgcgccaacgtgccg
gggcagcaggcggtcgccgtggcgatcggcggtcgccagagcatctacgaactgaccgcg
cccggaggtcggctcttcgagcagagccagcgcgccgccgacgccctcaacgccatcccc
ggcatcagctgcgtccgacccaggggcgcgctctacgtcttcccgaagatcgaccggaac
gtctacgacatccacgacgacgagaagttcgtcctcgacctgctcctgcaggagaagctg
cacatcgtgcagggcaccggattcaactggcccgagcccgaccacttccggatcgtcacg
ctcccgcacgccgacgagctcgaagcgatcatcgggcggatcggcaagttcctggcgacc
tatcgccagtga

DBGET integrated database retrieval system