KEGG   Gordonia phthalatica: ACH46_06615Help
Entry
ACH46_06615       CDS       T04097                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
goq  Gordonia phthalatica
Pathway
goq00564  Glycerophospholipid metabolism
goq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:goq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ACH46_06615
Enzymes [BR:goq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ACH46_06615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 FAD_binding_3 Pyr_redox_2 GIDA NAD_binding_8 Thi4 HI0933_like Pyr_redox 3HCDH_N AlaDh_PNT_C Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ALG84240
UniProt: A0A0N9NFW8
LinkDB All DBs
Position
1408809..1410551
Genome map
AA seq 580 aa AA seqDB search
MESEFNPDRPADLSPAYRDEAWRRLSEEQFDIVVIGGGVVGVGAALDAATRGLRVALVEA
RDIASGTSSRSSKMFHGGLRYLEQFEFGLVREALHERELSLRLLAPHLVRPLPFLAPLTR
RVWERPYMAAGLFLYDRMGGAKSVPGQRHVSRAGALRVAPSLKRDSLIGGIRYYDTVVDD
ARHSLTLARTASQYGAVIRTSTQAIGFLTESDRVMGVKVRDSETGETTEVRGHCVINAAG
VWTDEVQALSKRRGHFKVRASKGVHIVVPRDRIVSETAIILRTATSVLFVIPWETHWIIG
TTDTDWNLDLAHPAATRKDIDYILDRVNQELVTPLTHDDIEGVYAGLRPLLAGEDDQTSK
LSREHAVAVVAPGLVSIAGGKYTTYRVMGADAVEACNDYIPTRVAPSITERVPLVGADGY
FALINQCENLGERFGLHPYRIRRLLNRYGSLLDDVLYYADADASLLEPLTAAPQYLRAEI
VYAVWVEGALHLEDVLARRTRIAIEYSHRGVDCAQEVADLMAPILGWDEKTTAWEVANYT
ARVTAEKASQRQPDDESADALRAAAPEARREILEPVPVPE
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggagagcgagttcaaccccgatcgtcccgcggacctgagtccggcctatcgcgacgaa
gcctggcgacggttgagtgaggaacagttcgacatcgtcgtcatcggcggcggtgtggtc
ggcgtcggtgccgcgctcgacgcggcgacgcgcggtctgcgcgtggcgctcgtcgaagcc
cgcgacatcgcttcggggacgtcgagccggtcgtcgaagatgttccacggcgggctccgc
tacctggagcagttcgagttcggcctggtccgcgaagcgctccatgagcgtgagctctcc
ctgcggctgctggcgccgcatctggtgcgaccgctgcccttcctggccccgctgacgcgc
cgggtctgggagcggccgtacatggcggcgggcctgttcctgtacgaccggatgggcggc
gccaagtcggtacccggtcagcggcacgtcagtcgcgccggcgcactccgcgtggcgccg
agcctcaagcgcgactcgctcatcggcggcatccgctactacgacaccgtggtcgacgac
gcccgccacagcctgaccctggcgcgcaccgcctcccagtacggtgcggtgatccggacc
tcgacgcaggcgatcgggttcctcaccgagtccgaccgcgtgatgggcgtgaaggtccgc
gacagtgagaccggcgagaccaccgaggtccgcggccactgcgtcatcaacgcggccggc
gtgtggaccgacgaggtgcaggcgctctcgaagcgccgcggacacttcaaggtccgcgcg
tcgaagggcgtgcacatcgtggtgccccgcgaccgcatcgtgtccgagactgccatcatc
ctgcggacggcgacgtcggtgctgttcgtgatcccgtgggagacccattggatcatcggc
accaccgacaccgactggaatctcgacctcgcccatccggcggcgacgcgcaaggacatc
gactacatcctcgatcgcgtcaatcaggagctcgtgacgccgctgacgcacgacgacatc
gagggcgtgtacgccgggctgcgcccactgctcgccggtgaggacgatcagacgtcgaag
ctgtcgcgcgagcacgctgtcgctgtggtggcaccgggtctggtgtcgatcgcgggtggc
aagtacacgacgtaccgcgtgatgggcgccgacgcggtggaagcctgcaacgactacatc
cccacgcgtgtcgcgccgtcgatcaccgagcgggttccgctggtcggcgcggacggctac
ttcgcgctcatcaatcagtgcgaaaatctgggggagcggttcgggctgcacccgtaccgg
atccgtcgcctgctgaaccgctacggctcacttctcgacgacgtcctctactacgccgac
gccgatgcgtcactgctcgagccgctgacggcggccccgcagtacctgcgtgccgagatc
gtctacgcagtgtgggtggagggtgcactacacctggaggacgtcctcgcccgccggacc
cgcatagcgatcgagtacagccaccgcggcgtggactgcgcacaggaggtcgccgacctc
atggcgccgatcctcggctgggacgagaagaccaccgcctgggaggtcgcgaactacacc
gcgcgcgtgacggcggagaaggcgtcgcaacgccagcccgacgacgagtccgcggacgcc
ctgcgtgctgcggcacctgaggcccgccgcgagatcctggagccggtgcccgtacccgag
tag

DBGET integrated database retrieval system