KEGG   Gordonia phthalatica: ACH46_18985Help
Entry
ACH46_18985       CDS       T04097                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K14949  serine/threonine-protein kinase PknG [EC:2.7.11.1]
Organism
goq  Gordonia phthalatica
Brite
KEGG Orthology (KO) [BR:goq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:goq01001]
    ACH46_18985
Enzymes [BR:goq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     ACH46_18985
Protein kinases [BR:goq01001]
 Serine/threonine kinases: Other
  Bacterial family
   ACH46_18985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PknG_TPR PknG_rubred Pkinase Pkinase_Tyr TPR_19 TPR_4 TPR_14 TPR_16 DZR
Motif
Other DBs
NCBI-ProteinID: ALG86198
UniProt: A0A0N9NJP5
LinkDB All DBs
Position
4032919..4035399
Genome map
AA seq 826 aa AA seqDB search
MAADKSEKKKRKKKLREDEPVATQASDVEVHTQASDIDLADTGDAVQTQAGTMPAPMPTV
GTEASTMGTQAATTGAMTQSTQVRRILDDIAASRRKSRKNTHVHDRRLGADLVQLPEITD
IDPADAVLADPVITPSKRLCWKCGEPVGRKSGRGKGPLNGTCWNCGSRYSFVPGLKRGTI
VADQYEIAGAIAHGGMGWIYLAVDHNVSDRPVVLKGLLNSSDSQAQAVAISERQFLASVN
DPGIVKIFNFVEGTIDDGRSVGYIVMEYIGGHTLKQLTTGKTGKPKLLPIEQAMAYILEV
LSAVGYLHSVGLAYNDVKPDNIMITSDDVKLIDMGAVSAIDGTGHLYGTPGFQAPEIVQT
GPQIVTDIYSIGRTLAVLTVDMPMTAGRYDDGLPDPATTPLFVDNPSFYFLLQRSTSPDP
KERFSSAEEMTTQVLNVLRETVALHTGVPRPSMSTVFTPQRSTFGTELLLAPVDGFFDPK
DAAIHDPADIARALPVPLVDPSDPAASVLTSAALSYPRQTLDTIRAARADGFKALIVADR
SAADAAVDPMHPSVELDLAEARAHLELGNLDTALQLLREVALHHGDSWKLHWYLGICSLL
NAEPELAFERFHEVLVAMPGEVAPKLAVAGTAELIGYWLSAEEYTSNEQMAQVERWYEIA
RQNYHDLWLTDHAIVSAAFGLARMILAEGRFDSAIEPLDEVPTTSRHYGTAQISAIVTLV
HGRAPDEVTRAELFEAAERFEEISWDDPRRGRLQLIILGTALGWIDAHLDDDQAADDFLG
FPFNEQGLRAGTERSLRELAKATRDNRAHRFLLVDLANLIRPATLF
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgacaagagcgagaagaagaagcggaagaagaagctccgcgaggacgagccg
gtcgccacgcaggcgtccgacgtcgaggtgcacacgcaggcgtcggacatcgacctcgcc
gacacgggcgatgcggtgcagacgcaggcgggcaccatgcccgcaccgatgccgacggtc
ggcaccgaggcgtcgacgatggggacgcaggccgcgacgacgggtgcgatgacccagtcg
acgcaggtccgccggatcctcgacgacatcgccgcgtcgcgccggaagagccgcaagaac
acccacgtgcacgaccgccggctcggtgccgacctggtgcagctgccggagatcacggac
atcgacccggccgacgccgtcctcgccgatccggtcatcacgcccagcaagcgcctgtgc
tggaagtgcggtgagcccgtcggccgcaagtccggtcgcggcaagggcccactgaacggc
acctgctggaactgcggatcgcgctactcgttcgtgcccggcctcaaacgcggcaccatc
gtggccgaccagtacgagatcgcgggcgccatcgcgcacggcggcatgggatggatctac
ctcgcggtggaccacaacgtgtccgaccgccccgtcgtcctcaagggcctgctgaactcg
tcggactcgcaggcgcaggccgtcgcgatctccgaacggcagttcctcgcgtcggtcaac
gatcccggcatcgtgaagatcttcaacttcgtcgagggcaccatcgacgacggccggtcc
gtcggctacatcgtgatggagtacatcggcggtcacacgctcaagcagctgaccaccggg
aagaccgggaagccgaagctgctgccgatcgagcaggccatggcgtacatcctggaggtg
ctctcggccgtcggctacctgcattcggtggggctggcgtacaacgacgtgaagcccgac
aacatcatgatcacctccgacgacgtgaagctcatcgacatgggcgcggtgtcggcgatc
gacggcaccggccacctgtacggcaccccgggcttccaggcaccggagatcgtgcagacg
ggaccgcagatcgtcaccgacatctacagcatcggccgcacgctcgccgtcctgaccgtc
gacatgccgatgacggcgggccggtacgacgacggcctccccgacccggccaccaccccg
ctgttcgtcgacaacccgtcgttctacttcctgctgcagcggtccacgtcgcccgatccg
aaggagcgcttctcctccgcggaggagatgacgacgcaggtcttgaacgtgctgcgcgag
accgtcgccctgcacaccggcgtgccgcgcccgtccatgtcgaccgtgttcaccccgcag
cggtcgacgttcgggaccgagctgctgctggccccggtcgacggcttcttcgaccccaag
gacgccgcgatccacgatcccgccgacatcgcgcgcgctctgccggtgccgctcgtcgac
ccgtccgacccggcggccagcgtgctgacgtcggcggcgctgtcatatccgcggcagacg
ctcgacaccatccgcgccgcgcgggccgacggcttcaaggcgctgatcgtcgccgatcgc
agcgccgccgatgccgcggtggatccgatgcacccgtcggtggagctggacctggccgag
gcccgcgcgcatctggagctcgggaacctcgacaccgcgctgcaactgctgcgcgaggtg
gccctgcatcacggcgactcctggaagctgcactggtatctggggatctgttccctgttg
aacgccgaaccggagctggccttcgaacgcttccacgaagtcctcgtggcgatgccgggc
gaggtggcgccgaagctcgcggtggcgggcaccgccgagttgatcggctactggctgtcg
gccgaggagtacacctccaatgagcagatggcgcaggtggagcgttggtacgagatcgcc
cggcagaactatcacgacctgtggctcaccgatcacgcgatcgtgtcggccgcgttcggg
ctggcgcggatgattctcgccgagggccggttcgactccgcgatcgagccgctcgatgag
gtcccgaccaccagccgccactacggcaccgcgcagatctcggcgatcgtgacgctggtc
cacggtcgagcccccgacgaggtgactcgcgcggagctgttcgaggcggccgagcgcttc
gaggagatcagctgggacgacccccgacgcggccgcctccagttgatcatcctgggcacc
gccctcggctggatcgacgcccacctcgacgacgatcaggcggccgacgacttcctcggc
ttcccgttcaacgagcagggcctgcgcgcaggcaccgaacgctcccttcgtgaactcgcg
aaggcgacgcgcgacaaccgcgcccaccgcttcctcctcgtcgacctcgcgaacctgatc
cgccccgcgacgctgttctga

DBGET integrated database retrieval system