KEGG   Gordonia sp. KTR9: KTR9_0340Help
Entry
KTR9_0340         CDS       T02216                                 

Definition
(GenBank) Glutamate decarboxylase-related PLP-dependent protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
gor  Gordonia sp. KTR9
Pathway
gor00250  Alanine, aspartate and glutamate metabolism
gor00410  beta-Alanine metabolism
gor00430  Taurine and hypotaurine metabolism
gor00650  Butanoate metabolism
gor01100  Metabolic pathways
gor01110  Biosynthesis of secondary metabolites
gor01120  Microbial metabolism in diverse environments
gor02024  Quorum sensing
Module
gor_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:gor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KTR9_0340
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KTR9_0340
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KTR9_0340
   00430 Taurine and hypotaurine metabolism
    KTR9_0340
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    KTR9_0340
Enzymes [BR:gor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     KTR9_0340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AFR47006
UniProt: J9RWJ2
LinkDB All DBs
Position
complement(397332..398756)
Genome map
AA seq 474 aa AA seqDB search
MTTDEGVHNQSGGARATTNIGDAMSLRTVFTRTGEATELPKFSLSDSMLLPETAYQIVHD
EAMLDGNARLNLATFVSTWMDGEAQKLYAETVDKNMIDKDEYPQTAAIEDRCWRILADLW
HNPDVENAIGTSTIGSSEACMLGGLALKRHWQTRRRAEGKSTENPNIVLSTAVQVCWEKF
CNYFEVEPKWVPISPDHLVLDGHELEKYVDENTIGVVAIMGQTYTGMYEPVTAIAAKLDE
IQADTGLDVKIHIDGASGAMIAPFCQPDLEWDFRVDRVVSINTSGHKYGLVYPGVGWIVW
RDTEALPESMVFHCSYLGGDMPTLALNFSRPGAQVLLQYYMFLRLGRDGFTQVQQGSLDV
AQWLSSQIAQIDGLELVSKGDTIPVFAWKLKAGHTENWNLYDLSDRLRMKGWLVPAYPMA
DDLADLTVQRIVVRAGLSHDLARALIADIETEVQFLDRLESPMPREGDGSHFHH
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgacgagggcgtccacaaccaatccggcggagcgcgcgcgacgaccaacatc
ggcgatgcgatgtcgttgcggaccgtcttcacccggacgggcgaggccaccgagctcccc
aagttctcgctcagtgactcgatgttgttgccggagacggcatatcagatcgtccacgac
gaggcgatgctcgacggcaatgcgcgactgaacctcgcgaccttcgtctcgacatggatg
gacggcgaggcgcagaagctgtatgccgagaccgtcgacaagaacatgatcgacaaggac
gagtatccgcagaccgccgcgatcgaggaccggtgctggcgcatcctcgccgacctgtgg
cacaaccccgacgtcgagaatgccatcggcacctcgacgatcgggtcgtcggaggcgtgc
atgctcggcggactcgccctcaagcggcactggcagacgcggcgccgcgccgagggcaag
tcgaccgagaaccccaacatcgtgctgtcgacggcggtgcaggtctgctgggagaagttc
tgcaactacttcgaggtcgagccgaagtgggtgccgatcagtcccgaccacctcgtcctc
gacggtcacgaactcgagaagtacgtggacgagaacaccatcggggtcgtcgccatcatg
gggcagacctacaccggcatgtacgagccggtgaccgcgatcgcggccaagctcgacgag
atccaggccgacaccggcctcgacgtgaagatccacatcgacggtgcgtcgggtgcgatg
atcgcccccttctgccagcccgacctcgaatgggacttccgggtcgaccgtgtcgtctcg
atcaacacctccggccacaagtacggtctcgtgtacccgggcgtcgggtggatcgtgtgg
cgcgacaccgaagcactaccggagagcatggtgttccactgctcctacctcggcggtgac
atgccgacgctggcgctcaacttctcccgacccggcgcccaggtcttgctgcagtactac
atgttcctgcggctgggccgggacgggttcacccaggtccagcagggctccctcgatgtg
gcgcaatggctttcctcgcagatcgcccagatcgacgggctcgagttggtgagcaagggc
gacaccatcccggtcttcgcgtggaaactgaaggccgggcacaccgagaactggaatctc
tacgacctgtccgaccggctgcgcatgaagggctggctggttcccgcctacccgatggcc
gacgacctcgccgacctgaccgtgcagcgaatcgtcgtgcgcgccgggctcagtcacgat
ctcgcgcgtgcactcatcgcggacatcgagaccgaggtgcagttcctcgaccgcctcgag
agcccgatgccgcgcgagggcgacgggtcacacttccaccactga

DBGET integrated database retrieval system