KEGG   Gordonia sp. KTR9: KTR9_0350Help
Entry
KTR9_0350         CDS       T02216                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
gor  Gordonia sp. KTR9
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AFR47016
UniProt: J9RWJ8
LinkDB All DBs
Position
409856..410917
Genome map
AA seq 353 aa AA seqDB search
MSFMDLPVMPPVAPMLAKAVTSVPPQPDGSVAWSYEPKWDGFRALIFRDGDEVSIGSRGG
KDLARYFPEIVAAVKEELPEKVVLDGEIGVPALIGDTHRLDWDSLAQRIHPAESRVTMLA
EKTPAIFIGFDALALESTNVMAEPFEVRREALLRAVGPGGRDRRVHVSRVTSDPAVAEDW
FSAFEGAGLDGVVAKRLDGVYVENKREMLKIKHKRTADCVIFGYRIHKSGTGIGSMLLGL
YGDDGELRMVGGAGAFSDAKRIELQQMFEPMRLDPENASPGEPTRWRSEKSGEWIPIRPE
LVAEFAYDQMENHRFRHTVKFLRWRPDREPRSCGYDQLDVPLTYDLHDVLEGE
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcatggatctcccggtcatgccgcctgttgcgccgatgctggccaaggcggtg
accagcgtgccgccacagccggacggctcggtggcgtggtcgtatgaaccgaagtgggat
ggatttcgcgcgttgatcttccgcgacggcgacgaggtctcgatcggatcgcgtggcggg
aaggacctcgcacggtacttccccgagatcgtcgcggcggtgaaggaggaactgcccgag
aaggtggtcctcgacggcgagatcggggtacccgcgctcatcggcgacacccatcggctc
gactgggactcgctcgcgcagcggattcatccggcggagtcgcgcgtcaccatgctcgcg
gagaagaccccggcgatcttcatcggattcgatgcgctggcgttggagtcgacgaacgtg
atggccgagcccttcgaggtgcggcgggaggccctgctgcgggccgtcggtccgggcggg
cgggatcgtcgggtgcatgtcagccgggtgacgagcgacccggcggtcgccgaggactgg
ttctccgccttcgaaggggccggactcgacggtgtcgtcgccaaacgactcgacggcgtg
tacgtcgagaacaagcgcgagatgctgaagatcaaacacaagcggaccgcggactgtgtg
atcttcgggtatcgaatccacaagtcgggaaccgggatcggctcgatgctgctcggattg
tacggcgacgacggcgaattgcggatggtcggcggggcgggtgccttctccgacgccaag
cggatcgagctgcagcagatgttcgagccgatgcggctggacccggagaatgcatcaccg
ggtgaaccgacgcggtggcggtcggagaagtcgggggagtggatcccgatccgacccgaa
ctggtcgcggagttcgcctacgaccagatggagaaccaccggttccggcacacggtgaag
ttcctccgatggcgacccgatcgggagccacgcagttgcggctacgaccagctcgacgtc
ccgctgacctacgacctccacgacgtcctcgaaggggaatga

DBGET integrated database retrieval system