KEGG   Gordonia sp. KTR9: KTR9_1017Help
Entry
KTR9_1017         CDS       T02216                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
Organism
gor  Gordonia sp. KTR9
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Inhibitor_I48 Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AFR47662
UniProt: J9RGL4
LinkDB All DBs
Position
complement(1153114..1154568)
Genome map
AA seq 484 aa AA seqDB search
MTTIDSVRTSFFIDGGWRAPFGSATIPVISPLTEEQFGAVPEATTADVDAAVAAARTAFR
SSGWRDLSPADRAAHLRRFADELDKRAEDRASAVTSENGMPIALARFAEGAAPVQLLRYY
ADLVETTPVEETRTSQPLPGSTIVRREAIGVVGAIAPWNFPAILSMFKIAPALAAGCTVV
LKPSPETSLDAYVLAEAAIAAELPAGVLNIVNGGSEIGRHLVSHPHVDKVAFTGSTPAGR
EIGRVCGELIRPVTLELGGKSAALVLDDADLEQTVGGLATASLLNTGQTCYMSTRILVPG
SRYDEYLEAISTMCASLPVGDPMDENVAVGPLASGRHRDRVLSLIERGRSEGGTVTTGGG
TPSGVDRGFFVEPTVFAGVDNSATIAREEVFGPVLTVLRYDDVDDAIALANDSSYGLGGT
VWTSDPDRGVDVARRVETGSFGVNYFNLDWGSPFGGVKASGIGRELGPEGLAAYQNLKSI
FLPG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatcgactctgttcgcacgagttttttcatcgacggcggctggcgcgcaccg
ttcggctcggcgacgatcccggtcatctcgccgctgaccgaagagcagttcggcgcggta
cccgaagcgaccaccgccgacgtcgacgccgccgtcgcggcggcccgcaccgccttccgg
tcgtcgggctggcgcgacctgtccccggccgaccgtgccgcacatctgcgccggttcgct
gacgaactcgacaaacgagccgaggatcgcgcgtcggccgtgacgtccgagaacggcatg
cccatcgcgctggcacggttcgccgagggcgcggccccggtccagctgctgcgctactac
gccgacctcgtcgagaccaccccggtcgaagagaccaggaccagccaaccgctgcccggg
tcgacgatcgtgcgccgcgaggccatcggcgtcgtcggggcgatcgcgccgtggaacttc
ccggcgatcctctcgatgttcaagatcgctcccgccctcgcggccggctgcaccgtcgtc
ctcaaaccgtcgccggagacgagtctcgacgcctacgtcctcgccgaggcggccatcgcc
gccgaactgcccgccggcgtcctcaacatcgtcaacggcggcagcgagatcggccgccac
ctggtgtcgcacccgcacgtcgacaaggtcgcgttcaccggctcgaccccggccggccgc
gagatcggccgtgtctgtggcgaactcatccgtccggtgaccctcgagctcggcggcaag
tccgcagccctggtgctcgacgacgccgacctggagcagaccgtcggtggactggccacc
gcgtccctgctgaacaccggccagacctgctacatgtccacccgaatcctggtgcccggc
agccgttatgacgagtacctcgaagccatcagcacgatgtgcgcgtcgttgccggtcggc
gaccccatggacgagaacgtggccgtcggcccgctggcgagcggccgacaccgcgaccgg
gtgctgtccctgatcgagcgcggccgatcagagggcggcacggtcaccaccggcggcgga
actccgtcgggtgtcgaccgggggttcttcgtcgagccgaccgtcttcgccggcgtcgac
aactcggccaccatcgcccgcgaagaggtcttcgggccggtgctgaccgtgctgcgctac
gacgacgtcgacgacgccatcgctctggccaacgattcgtcgtacggcctgggcggaacg
gtgtggacctccgaccccgaccgcggcgtcgacgtcgcccgccgcgtcgagaccgggtcg
ttcggggtcaactacttcaacctcgactggggttcaccgttcggcggcgtcaaggccagc
ggcatcggccgcgaactcggacccgagggtctcgccgcctaccagaacctcaagtcgatc
ttcctgccgggctga

DBGET integrated database retrieval system