KEGG   Gordonia sp. KTR9: KTR9_1182Help
Entry
KTR9_1182         CDS       T02216                                 

Definition
(GenBank) ABC-type uncharacterized transport system, ATPase component
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
gor  Gordonia sp. KTR9
Brite
KEGG Orthology (KO) [BR:gor00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gor02000]
    KTR9_1182
Transporters [BR:gor02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    KTR9_1182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 DUF4162 AAA_23 MukB AAA_29 SbcCD_C AAA_30 AAA_15
Motif
Other DBs
NCBI-ProteinID: AFR47822
UniProt: J9RH56
LinkDB All DBs
Position
complement(1337269..1338165)
Genome map
AA seq 298 aa AA seqDB search
MTAPLIVDGLHKRYGDLVALHDMTFDVDPGEIFGFVGSNGAGKSTTMRIILGVLSADAGE
VRLGDRPIDLDLRRHIGYMPEERGLYPKMKVGEQLTFLAKLHGMSAAEAEDSVRRWTDRL
GVGARYDDNVADLSLGNQQRVQLAAALVHDPAVLVLDEPFSGLDPVAVDVMSDVLKEKAA
EGIPVIFSSHQLDLVQRLCDRVGIITRGEMRALGTVDDLRSRDGVTLEVSGPRSDVAWAD
ALPGVRGVDYGETTRLLIDPEVADDQLILSTALNHGPVHRFATSTPSLTDLFREVVSA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgccgctgatcgtcgacgggctccataagcgctacggagaccttgtcgcattg
cacgacatgacctttgacgtcgaccccggtgagatattcggcttcgtcgggagcaacggc
gcaggcaagtccacgacgatgcgcatcatcctcggcgtgctgtcggcagacgccggtgag
gtccgcctgggcgatcgcccgatcgacctggatctacgtcgccacatcgggtacatgccc
gaggaacgcggcctgtacccgaagatgaaggtgggcgaacaactcaccttcctcgcgaag
ctgcacggcatgtccgcggcggaggcggaggactccgtccggcgctggaccgaccggctc
ggcgtcggggcgcgctacgacgacaacgtcgccgacctcagcctcggcaatcaacagcgt
gtccagctcgcggccgccctcgtgcacgacccggccgtactggtgctcgacgaaccgttc
tccggcctcgacccggtcgccgtcgacgtcatgagcgacgtgctcaaagagaaggcggcc
gaaggcatcccggtcatcttctcctcgcatcagctcgacctcgtccaacggctctgcgac
cgggtgggcatcatcacccgcggtgagatgcgggccctgggcaccgtcgacgacctgcgt
tcccgcgacggggtcaccctcgaggtcagcggcccccggtccgacgtcgcatgggccgat
gccctccccggggtccgcggtgtcgactacggcgagacgacccgcctcctgatcgacccc
gaggtcgccgacgatcagttgatcctgtcgaccgcgctgaatcatggcccggtccaccgg
ttcgcgacctccacaccgtccctgaccgacctgttccgagaggtggtgtccgcatga

DBGET integrated database retrieval system