KEGG   Gordonia sp. KTR9: KTR9_2560Help
Entry
KTR9_2560         CDS       T02216                                 

Definition
(GenBank) Threonine dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
gor  Gordonia sp. KTR9
Pathway
gor00260  Glycine, serine and threonine metabolism
gor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KTR9_2560
Enzymes [BR:gor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     KTR9_2560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AdoHcyase_NAD 2-Hacid_dh_C ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: AFR49197
UniProt: J9RLJ6
LinkDB All DBs
Position
complement(2928536..2929579)
Genome map
AA seq 347 aa AA seqDB search
MRAVLKTAAERGVEYVTDAPDPKATDGHVVIEVAAASLCGTDRELYEWTPSAQAFNLSLP
VVLGHEGAGTVVEVGPGVTDLEVGDRVALESHLICGRCYACRTGDAHTCERTRIIGMHID
GLFAEYMNVPQDICVKLPEGLSFESGALLEAAGVAVHAVQRANYSVAGRAVLVSGAGPVG
LVVAYLAQLMGAAYVVAVEPNPYRRAQAEKLGVIAMAPDDDPVQRCLELTGARGGFDVAF
ECSGAPVALGTLFEALRREATVITVGHPSRPVDIDIAQFINKKGITLRGIFGRRLWETWE
QSLLLLDSGRLDLDWLVTHRKKLSDVDKAIDLLTGDACKVLLVPGMG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagtactgaagaccgcggccgagcgcggagtcgaatacgtcaccgacgcaccc
gatccgaaagcgaccgacggtcacgtggtgatcgaggtggccgccgcgtcactgtgcggc
accgaccgcgaactctatgagtggacaccctcggcgcaggcgttcaacctgtcacttccg
gttgtcctggggcatgaaggtgccggcaccgtggtcgaggtcggacccggggtcaccgac
ctcgaggtcggcgaccgtgtcgcactcgagagccacctcatctgcggccggtgctatgcc
tgccgaacaggcgacgcccacacgtgcgaacgaacccgcatcatcggaatgcacatcgac
ggcttgttcgccgagtacatgaacgttccgcaggacatttgcgtgaaactccccgagggc
ctgtccttcgagtccggtgcactgctggaagcagcaggagtcgcggtccacgcagttcag
cgcgcgaactactccgtggcgggtcgtgcggtcctcgtcagcggcgcagggccggtggga
ctggtcgtggcctacctggcccagctcatgggtgccgcgtacgtcgtcgcggtcgagccc
aatccctaccgtcgcgctcaagccgagaaactcggcgtcatcgccatggcgcctgacgac
gaccctgtgcagagatgtctcgaactgaccggcgcacgagggggattcgacgtcgcgttc
gagtgctccggcgccccggtcgcactcggcaccctgttcgaggcactacgccgcgaagcg
accgtcatcaccgtgggccacccgagccggcccgtcgacatcgacatcgcacagttcatc
aacaagaagggcatcaccctgcgcggcatcttcggccgccggctctgggagacctgggag
cagagcctgctgctcttggactccggccggctcgacctggactggctcgtcacacaccgc
aagaagctcagcgatgtcgacaaagccatcgatctgctgaccggcgacgcatgcaaggtg
ctgctcgtcccaggaatgggctga

DBGET integrated database retrieval system