KEGG   Gordonia sp. KTR9: KTR9_3040Help
Entry
KTR9_3040         CDS       T02216                                 

Definition
(GenBank) Cell wall-associated hydrolases (invasion-associated proteins)
Organism
gor  Gordonia sp. KTR9
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NLPC_P60 CHAP Peptidase_C92 Amidase_5
Motif
Other DBs
NCBI-ProteinID: AFR49675
UniProt: J9SB16
LinkDB All DBs
Position
complement(3511553..3512236)
Genome map
AA seq 227 aa AA seqDB search
MAKHRLEQPNRGSTVAKKAVIAGSITLGSLAAAAGPALAAPVHTPLGTFEIPALPGAKAP
DAKPAPPATPVKKSPAATVEIPNLGQFTVPGIAPDQIPQQFRPQGGAPLGQPQLTAGEKA
VKAAESKIGSPYSYGSAGPNAFDCSGLVYWSYKQAGKNIPRDSYGQLGGGRAVSYSEAKP
GDVMIFNGGGHAGIYVGNGQFVHSSNYGTPVKRDAVKEWTLTGIRRY
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtggccaaacatcgtttggaacagcccaatcgtggcagcacggtcgccaagaaggcggtg
atcgccggatcgatcacgctcggttcgctcgccgcagccgccggccctgctctcgccgcc
ccggtccacaccccgctggggactttcgagatcccggccctgcccggtgcgaaggccccg
gacgccaagcccgcacccccggcgacgcccgtgaagaagtcgcccgcggccacggtcgag
atccccaaccttggacagttcaccgtgccgggcatcgcccctgaccagattccccagcag
ttccgtccgcagggcggcgcgcccctgggccagccgcagctgaccgcgggtgagaaggcc
gtcaaggccgctgagagcaagatcggctcgccgtactcctacggttccgccggccccaac
gcattcgactgctcgggtctcgtctactggtcctacaagcaggccggcaagaacattccg
cgcgacagctacggccagctcggcggcggacgtgcggtgtcctactccgaagccaagccg
ggcgacgtcatgatcttcaacggtggcggccacgccggcatctatgtcggcaacggccag
ttcgtccactcgtccaactacggcacgccggtcaagcgcgacgccgtcaaggagtggacc
ctgacgggaatccgtcgttactga

DBGET integrated database retrieval system