KEGG   Gordonia sp. KTR9: KTR9_4205Help
Entry
KTR9_4205         CDS       T02216                                 

Definition
(GenBank) aspartate aminotransferase / tyrosine aminotransferase / aromatic aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
gor  Gordonia sp. KTR9
Pathway
gor00220  Arginine biosynthesis
gor00250  Alanine, aspartate and glutamate metabolism
gor00290  Valine, leucine and isoleucine biosynthesis
gor01100  Metabolic pathways
gor01110  Biosynthesis of secondary metabolites
gor01130  Biosynthesis of antibiotics
gor01210  2-Oxocarboxylic acid metabolism
gor01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KTR9_4205
   00290 Valine, leucine and isoleucine biosynthesis
    KTR9_4205
   00220 Arginine biosynthesis
    KTR9_4205
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gor01007]
    KTR9_4205
Enzymes [BR:gor01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     KTR9_4205
    2.6.1.66  valine---pyruvate transaminase
     KTR9_4205
Amino acid related enzymes [BR:gor01007]
 Aminotransferase (transaminase)
  Class I
   KTR9_4205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AFR50812
UniProt: J9RRY1
LinkDB All DBs
Position
4829312..4830565
Genome map
AA seq 417 aa AA seqDB search
MSRPHVSHLNQNLKPLEQSLKLQNVCYEIRGPVHAHAQRLEAEGHRILKLNIGNPALFGF
EAPDVIMRDMIHALPYAQGYSESAGVLSARRAVVTRYELIPDFPYFDVDDVILGNGVSEL
ITMTMQALLNDGDEVLIPAPDYPLWTAMTSLSGGQPVHYRCDEENGWNPDVADIAAKITD
RTKAIVIINPNNPTGAVYSREVLKQLVELARQHSLLILADEIYDKIIYDDAEHVNVASLA
PDLLCLTFNGLSKAYRVCGYRAGWVVMTGPKDHARGFIEGMGILASTRLCANVPGQHAIQ
VALGGYQSIEALVSPGGRLYEQRNVTWEKLNEIPGVSCVKPKGALYAFPRLDPEVYEIHN
DELFVQDLLLQEKILVVQGTGFNLDDHNHFRIVTLPWSRDLTEAVERIGNFLSSYRQ
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaggccccatgtttcgcacctcaaccagaacctcaagccgctcgagcagtcgctc
aagttgcagaacgtgtgctacgagatccgcggtcccgtccacgcgcacgcgcagcgcctc
gaggcagaaggccaccggatcctcaagctgaacatcggcaacccggcgttgttcggtttc
gaggcccccgacgtgatcatgcgcgacatgatccacgccctcccctacgcacagggctac
tccgagtccgccggtgtcctctcggcgcgtcgtgccgtcgtgacccgctacgagctcatc
cccgacttcccgtacttcgacgtcgacgacgtcatcctgggcaacggtgtctccgagctc
atcaccatgacgatgcaggcgctgctgaacgacggcgacgaggtcctgatccccgcgccc
gactacccgctctggaccgcgatgacctcgctgtccggcgggcagcccgtgcattaccgc
tgcgacgaggagaacgggtggaaccccgacgtcgccgacatcgccgcaaagatcaccgac
cgcaccaaggcgatcgtcatcatcaacccgaacaacccgaccggcgcggtctactcacgt
gaggtcctcaagcagctcgtcgaactcgcacggcagcattcgctgctgattctggccgac
gagatctacgacaagatcatctacgacgacgccgagcacgtgaacgtggcgtcgctggcg
ccggatctgttgtgcctcacgttcaacggtttgtcgaaggcgtaccgcgtctgcggttac
cgcgccggatgggtcgtgatgaccggaccgaaggaccacgcccgcggcttcatcgagggc
atgggcatcctggcatcgacgcgtctgtgcgccaacgtgccgggccagcacgcgatccag
gtggcgctcggcggataccagtccatcgaggccctggtctcccccggcggccggctgtac
gaacaacgcaacgtcacatgggagaagctcaacgagatccccggggtcagctgcgtgaaa
cccaagggcgcgttgtacgcgttcccccgcctcgaccccgaggtctacgagatccacaac
gacgagctgttcgtccaggacctgctgctgcaggagaagatcctcgtggtccagggcacc
ggcttcaacctcgacgaccacaaccacttccgcatcgtgaccctgccgtggtcgcgggat
ctgaccgaggccgtggaacgtatcggcaacttcctgtcgtcgtatcggcagtga

DBGET integrated database retrieval system