KEGG   Gemella sp. oral taxon 928: AXE85_00230
Entry
AXE85_00230       CDS       T04256                                 

Definition
(GenBank) adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
got  Gemella sp. oral taxon 928
Pathway
got00230  Purine metabolism
got00730  Thiamine metabolism
got01100  Metabolic pathways
got01110  Biosynthesis of secondary metabolites
got01240  Biosynthesis of cofactors
Module
got_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:got00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AXE85_00230
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    AXE85_00230
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:got04147]
    AXE85_00230
Enzymes [BR:got01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     AXE85_00230
Exosome [BR:got04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AXE85_00230
SSDB
Motif
Pfam: ADK AAA_17 ADK_lid AAA_18 AAA_33 TF_Zn_Ribbon Rpr2
Other DBs
NCBI-ProteinID: AME10128
UniProt: A0A0X8KN87
LinkDB
Position
complement(59878..60531)
AA seq 217 aa
MNIILMGLPGAGKGTQADQIKVNYPIPHISTGDMFRAAIKNETPLGKEAKSYIDKGQLVP
DSVTIGLVEERLNQEDAKEGFLLDGFPRTVEQAEALDQILAKTNRKIDKVLNIDVDPTIL
LPRLTGRRICKQCGTTYHLIFNPTKVEGVCDKDGGELYQRSDDNEETVANRLEVNIKQTK
PLLDFYSQKEDVVENINGDQDIKVVFKDVQNILDKLK
NT seq 654 nt   +upstreamnt  +downstreamnt
atgaatattattctaatgggattgccgggggcaggaaagggaactcaggcagatcaaatc
aaagtgaattatccaattccgcatatttcaacaggagatatgtttagagctgcgattaaa
aatgagacaccgcttggaaaagaagcaaaaagttatattgataaaggacaacttgttcct
gacagcgtaactataggattagttgaagaaagattgaatcaagaagatgcaaaagaaggc
tttttacttgacggttttccaagaacagtagaacaagctgaagcccttgatcaaatttta
gcaaaaactaatagaaaaattgataaagtattaaacattgatgtagatccgactatctta
ttaccaagattaacaggtagaagaatctgtaagcaatgtggcactacatatcacttaatc
ttcaatccgacaaaagttgaaggtgtttgtgataaagatggtggagagttataccaacgt
agcgatgacaacgaagaaacagttgcaaatcgtttagaagtaaatattaaacaaactaaa
ccattattagacttttatagtcaaaaagaagatgtagttgaaaatattaacggtgatcaa
gacatcaaggtagtgttcaaagacgtgcaaaatatattagacaaactgaaatag

DBGET integrated database retrieval system