KEGG   Gemella sp. oral taxon 928: AXE85_03315
Entry
AXE85_03315       CDS       T04256                                 

Definition
(GenBank) S-ribosylhomocysteinase
  KO
K07173  S-ribosylhomocysteine lyase [EC:4.4.1.21]
Organism
got  Gemella sp. oral taxon 928
Pathway
got00270  Cysteine and methionine metabolism
got01100  Metabolic pathways
got01230  Biosynthesis of amino acids
got02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:got00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AXE85_03315
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AXE85_03315
Enzymes [BR:got01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.21  S-ribosylhomocysteine lyase
     AXE85_03315
SSDB
Motif
Pfam: LuxS
Other DBs
NCBI-ProteinID: AME09248
UniProt: A0A0X8KLG9
LinkDB
Position
complement(738040..738510)
AA seq 156 aa
MTNKKMNVESFNLDHTKVVAPYIRLVGVYSGENGDKIYKYDIRFCQPNKEHLAMPSLHSL
EHLIAELIRNHLDNVLDFGPMGCQTGFYLSVINNDSYEAVVEALTKTLEDVLVATEVPAC
NEIQCGWAASHSLKGAKQEAIKFLDKKSEWKNVFGK
NT seq 471 nt   +upstreamnt  +downstreamnt
atgactaataaaaaaatgaatgttgaaagttttaaccttgatcatactaaagtagttgca
ccttatattaggcttgttggagtatatagcggagaaaatggtgataaaatatataaatat
gatattagattttgccagccgaataaagaacatttagcaatgccaagccttcattctctt
gaacatttaattgcagaattaattcgtaatcaccttgataatgttttggattttggacca
atgggttgtcaaacagggttttatttatcagtaataaataatgatagctatgaggcggta
gtagaagctcttaccaagacgttggaagatgttcttgttgctactgaagtcccggcttgc
aatgaaatacaatgcggctgggcagcttctcactccctaaaaggcgctaagcaagaagct
ataaaattcctagataaaaaatctgaatggaaaaacgtatttggtaagtaa

DBGET integrated database retrieval system