KEGG   Gemella sp. oral taxon 928: AXE85_07215
Entry
AXE85_07215       CDS       T04256                                 

Definition
(GenBank) S-adenosylmethionine synthetase
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
got  Gemella sp. oral taxon 928
Pathway
got00270  Cysteine and methionine metabolism
got01100  Metabolic pathways
got01110  Biosynthesis of secondary metabolites
got01230  Biosynthesis of amino acids
got01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:got00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AXE85_07215
Enzymes [BR:got01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     AXE85_07215
SSDB
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_M S-AdoMet_synt_N
Other DBs
NCBI-ProteinID: AME09945
UniProt: A0A0X8KMP7
LinkDB
Position
complement(1555728..1556909)
AA seq 393 aa
MSKTYLFTSESVTEGHPDKIADQISDAILDEILKQDPYGRVACETCVNTGLAVLVGEIST
TANIDFQQIVRNTINEIGYNDPRNGYSGDHISVLIGLDKQSPDIALGVDNSLETKESSEV
KEVGAGDQGLMFGFATNETDSYMPLPIYLSHKLSKQLADVRKDGTLSYLGPDGKVQVTVE
YDINHKVKRIDTIVVSAQHDKEIPQKQIHADIKKYVVEPCLDRELLDENTKYFINPTGRF
VIGGPVGDAGLTGRKIIVDTYGGFSRHGGGAFSGKDATKVDRSGAYMARYIAKNIVASGV
CDKIEVQLAYAIGVANPVSIFVETFGTSKVDEGEIVKTIKKEFKLTPNGIIETLDLRRPI
FKKTAAYGHFGRDDEDFTWERLDRVEEFKKLLK
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgagtaaaacatatttatttacatcagaatcagtaacagaggggcatccggataaaatt
gcagatcaaatatctgacgcaattttagatgagattttaaaacaagatccatacggaaga
gtggcgtgtgaaacttgtgttaacaccggtttagcagttctcgttggagaaatatcaaca
acggctaatatagattttcaacaaatagtaaggaatactataaatgaaataggatataat
gatccgagaaatggctattcaggagatcatatttcggttcttataggacttgataaacaa
tcacccgatattgcacttggagttgataattctttagaaactaaagaatcatctgaagta
aaagaggtaggtgcaggagatcaaggtttaatgttcggttttgcaactaatgaaacagat
tcttatatgccattacctatttatctaagtcataaattgtcaaaacaattggcagatgtt
agaaaagatggaactttatcttatctaggacctgatggaaaagttcaagttacagtagaa
tatgacattaatcataaagtaaaaagaattgatactatagtagtatcggctcagcacgat
aaagaaatacctcaaaaacaaattcatgctgatattaaaaaatatgtagtagaaccatgt
ttagatagagaattgttagatgagaatacgaaatattttattaatccaacaggtcgtttt
gtaataggaggaccggtaggagatgccggtttaacaggaagaaaaataatcgttgataca
tatggcggtttttctcgacatggtggaggtgcatttagcggtaaagatgcaacgaaagtt
gatcgttccggagcatatatggcacgttatattgctaaaaatattgtagcaagtggggtc
tgcgataaaattgaagttcaattggcatacgctattggtgttgctaatccggtatcaatt
ttcgtagaaacattcggaacttcaaaagttgatgagggagagattgttaaaaccataaaa
aaagaattcaagttgacaccaaacggtataattgaaacattagatttaagaagaccaatt
ttcaaaaaaactgccgcttatggccactttggacgtgatgatgaggactttacttgggaa
agattggacagagtagaggaatttaaaaaattattaaaatag

DBGET integrated database retrieval system