KEGG   Gemella sp. oral taxon 928: AXE85_07450
Entry
AXE85_07450       CDS       T04256                                 

Definition
(GenBank) ATP synthase subunit alpha
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Organism
got  Gemella sp. oral taxon 928
Pathway
got00190  Oxidative phosphorylation
got01100  Metabolic pathways
Module
got_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:got00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AXE85_07450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:got00194]
    AXE85_07450
Enzymes [BR:got01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     AXE85_07450
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     AXE85_07450
Photosynthesis proteins [BR:got00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   AXE85_07450
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N Arginosuc_synth
Other DBs
NCBI-ProteinID: AME09990
UniProt: A0A0X8KMS5
LinkDB
Position
complement(1607618..1609120)
AA seq 500 aa
MAIKAEEISALLKSQIENYQFEVKSTDVGTVIEVGDGIARVYGLNEIMSGELVEFTKTGV
MGLAQNLEDTNVGIVILGPTTDIKEGDEVRRTGRVMDVPVGEELIGRVVDPLGQPVDGRG
PVNTNKRRPIESPAVGVMGRKSVSVPFQTGIKAIDSLVPIGRGQRELIIGDRQTGKTAVA
IDSILAQKGQDVICIYVAIGQKESTVRSVVETLKEHGALEYTIVVTAAASQPAPLLYIAP
YAGVAMAEEFMFNGKDVVIVYDDLSKQAAAYRELSLLLKRPPGREAYPGDVFYLHSRLLE
RAARVNEDFGGGSITALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFFSGIRPAINA
GLSVSRVGGSAQIKAMKKVSGTLRLDLASYRELESFAQFGSDLDPATREKLERGKRTVEV
LKQDLHKPIPVEKQVMILYALTHGYLDDVEVKDIHRFEQELYAYLDAHPTEAIRYIQETK
DLPEEKVMNEVIETFKKTFA
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggctattaaagctgaagagattagtgcattactaaaatcgcaaatagaaaattatcag
tttgaagttaagtcaacggatgtcggaacagtaattgaagtaggggacggtatagcacgt
gtatatggtcttaacgaaataatgagtggagagcttgttgaatttacaaaaaccggagtt
atggggcttgctcaaaaccttgaagatactaatgtcgggattgtaattttaggaccaact
accgatattaaagaaggtgatgaagtaagacgtaccggacgtgttatggacgttcctgtt
ggagaagaattaattggacgtgtagtagatccgttgggtcaaccggtagacgggcgtggt
ccggtaaatacaaataaaagaagaccgatagaatcgccggctgtcggagttatggggcgt
aaatctgtatctgttccattccagacaggtattaaagcgatagactcattggtaccgatt
gggcgaggacaacgtgaacttattatcggtgatagacaaacaggtaaaacagctgttgca
atagattcaattttggctcaaaaaggtcaggatgttatttgtatctacgttgctatcggt
caaaaagaatcaacagttcgtagtgttgttgaaacgttaaaagaacatggggcattagaa
tataccattgttgtaacagcagcggcttcgcaaccggcaccgttactatatatagcaccg
tatgcaggggtagctatggctgaagaatttatgtttaatggaaaagatgtagtaatagta
tatgatgatttatctaaacaagcagcagcttatcgtgagttatcattactacttaaacgt
ccaccggggcgtgaggcatatccgggggatgtattctatctgcacagccgtttattagaa
cgtgcggcacgtgttaacgaagattttggtggtggaagtattacagcattaccgtttgtt
gaaacccaagccggggatatttctgcgtatattccaactaatgttatttctattacagac
gggcaaattttcttacaatcagacctatttttctctggtatcagaccggcaattaatgca
ggattgtccgtatctcgtgtagggggatctgcacaaattaaagccatgaaaaaagtatca
gggacattacgtcttgacttggcatcatacagagaactggaaagttttgcacaattcggt
tctgatttagatccggcaactcgtgaaaaacttgaacgaggtaaacgtacggtagaggta
ttaaaacaagatttacataaacctattcctgtagaaaaacaagtaatgattttatatgct
ctaacacatggttatttagatgatgttgaagtgaaagatatacatagatttgaacaagaa
ttatatgcttatcttgatgcacatccgacagaagctataagatatatacaagaaacaaaa
gatttacctgaagaaaaagttatgaatgaagttattgaaacattcaaaaaaacttttgct
tag

DBGET integrated database retrieval system