KEGG   Gemella sp. oral taxon 928: AXE85_07465
Entry
AXE85_07465       CDS       T04256                                 

Definition
(GenBank) ATP synthase F0F1 subunit C
  KO
K02110  F-type H+-transporting ATPase subunit c
Organism
got  Gemella sp. oral taxon 928
Pathway
got00190  Oxidative phosphorylation
got01100  Metabolic pathways
Module
got_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:got00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AXE85_07465
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:got00194]
    AXE85_07465
Photosynthesis proteins [BR:got00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   AXE85_07465
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-ProteinID: AME09993
UniProt: A0A0X8KMY4
LinkDB
Position
complement(1610259..1610474)
AA seq 71 aa
MVGLIGAGLAAGLAAIGAGIGNGYLFGKFMEGVSRQPEIEPKLKSNAFVMFALVEAVPIL
AIVVAFILSFK
NT seq 216 nt   +upstreamnt  +downstreamnt
atggtaggattaattggagcaggattggcagcaggattggcagcgattggtgccggtatt
ggtaacggatatttattcggtaaatttatggaaggtgtttctcgtcaacctgaaatcgaa
cctaaacttaaatctaatgcgtttgtaatgtttgcacttgttgaagcggtgcctatctta
gctatcgtagtagcgtttattctttcattcaaataa

DBGET integrated database retrieval system